BLASTX nr result
ID: Rehmannia24_contig00015858
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00015858 (326 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ10443.1| hypothetical protein PRUPE_ppa007177mg [Prunus pe... 55 1e-05 >gb|EMJ10443.1| hypothetical protein PRUPE_ppa007177mg [Prunus persica] Length = 379 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/59 (42%), Positives = 39/59 (66%) Frame = -2 Query: 178 MVESIAATSLLGHRPIYGSYHFRDVPNKRKPAADHCRLTFTKFIGRKVSFSAFSPRFSV 2 M ESI +TSLLGHRP+Y +DV NKR+ ++D+CR + +GR+++ + P+ V Sbjct: 1 MAESITSTSLLGHRPLYTGAFIKDVSNKRR-SSDNCRFPMAEILGRRITMAPPLPKLRV 58