BLASTX nr result
ID: Rehmannia24_contig00014225
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00014225 (593 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS69916.1| hypothetical protein M569_04846, partial [Genlise... 60 6e-07 >gb|EPS69916.1| hypothetical protein M569_04846, partial [Genlisea aurea] Length = 452 Score = 59.7 bits (143), Expect = 6e-07 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = -1 Query: 590 FPYGNLNIFIRQPDGSYAGDSLDSPTGDLDE 498 FP GNLNIFIRQPDGSYAGDSLDSP D DE Sbjct: 422 FPSGNLNIFIRQPDGSYAGDSLDSPKSDCDE 452