BLASTX nr result
ID: Rehmannia24_contig00013991
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00013991 (494 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS66903.1| hypothetical protein M569_07873, partial [Genlise... 61 2e-07 >gb|EPS66903.1| hypothetical protein M569_07873, partial [Genlisea aurea] Length = 381 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/60 (50%), Positives = 40/60 (66%) Frame = -1 Query: 197 MGRWRAPLIVSRIISASKSINNLNFHKAPSLRSQNSPLISKPRDYFSNFRSFSALPSVSP 18 MGRWR P+I+ I+ ASKSI NLN + +S + ++ +PR + SN R FSALPS SP Sbjct: 1 MGRWRTPVILDHILRASKSIGNLNSSRNACPKSLFASIVLQPRIFLSNLRWFSALPSPSP 60