BLASTX nr result
ID: Rehmannia24_contig00012311
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00012311 (337 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003599189.1| hypothetical protein MTR_3g029970 [Medicago ... 61 2e-07 ref|XP_003599331.1| hypothetical protein MTR_3g031730 [Medicago ... 57 3e-06 emb|CBI27585.3| unnamed protein product [Vitis vinifera] 57 3e-06 >ref|XP_003599189.1| hypothetical protein MTR_3g029970 [Medicago truncatula] gi|355488237|gb|AES69440.1| hypothetical protein MTR_3g029970 [Medicago truncatula] Length = 61 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/39 (71%), Positives = 30/39 (76%) Frame = +2 Query: 2 RTQAPAVTNQDLGSTTWADLRRVPLQSAMEDANLGHEPS 118 RTQAP TN D+GSTTW DLR+ PLQSAME LGH PS Sbjct: 23 RTQAPTATNYDVGSTTWVDLRKAPLQSAMEVTFLGHGPS 61 >ref|XP_003599331.1| hypothetical protein MTR_3g031730 [Medicago truncatula] gi|355488379|gb|AES69582.1| hypothetical protein MTR_3g031730 [Medicago truncatula] Length = 65 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/39 (69%), Positives = 28/39 (71%) Frame = +2 Query: 2 RTQAPAVTNQDLGSTTWADLRRVPLQSAMEDANLGHEPS 118 RTQAP TN D+GSTTW DLR PL SAME LGH PS Sbjct: 27 RTQAPTATNYDVGSTTWVDLRLAPLLSAMEVTCLGHGPS 65 >emb|CBI27585.3| unnamed protein product [Vitis vinifera] Length = 105 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/47 (59%), Positives = 32/47 (68%) Frame = +2 Query: 2 RTQAPAVTNQDLGSTTWADLRRVPLQSAMEDANLGHEPS*SPIDPVR 142 RT+ P+ TN D+ S TWADLR VPL SAME LGH S S IDP + Sbjct: 42 RTRTPSTTNYDVDSATWADLRAVPLPSAMEVTVLGHGSSRSAIDPAQ 88