BLASTX nr result
ID: Rehmannia24_contig00009471
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00009471 (316 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFB18635.1| CESA6 [Gossypium hirsutum] 93 3e-17 gb|ACS88359.1| cellulose synthase catalytic subunit [Gossypium h... 93 3e-17 ref|XP_004291468.1| PREDICTED: cellulose synthase A catalytic su... 93 4e-17 gb|EOY31461.1| Cellulose synthase 1 [Theobroma cacao] 92 7e-17 gb|AGC97433.2| cellulose synthase [Boehmeria nivea] 92 9e-17 gb|AAY78952.3| cellulose synthase CesA1 [Boehmeria nivea] 92 9e-17 gb|AFZ78556.1| cellulose synthase [Populus tomentosa] 91 2e-16 ref|XP_002308657.1| cellulose synthase family protein [Populus t... 91 2e-16 gb|AAO25536.1| cellulose synthase [Populus tremuloides] 91 2e-16 gb|EMJ22782.1| hypothetical protein PRUPE_ppa000611mg [Prunus pe... 90 3e-16 ref|XP_002515536.1| Cellulose synthase A catalytic subunit 6 [UD... 90 3e-16 ref|XP_006361724.1| PREDICTED: cellulose synthase A catalytic su... 89 5e-16 ref|XP_004245031.1| PREDICTED: cellulose synthase A catalytic su... 89 5e-16 gb|AAP97497.1| cellulose synthase [Solanum tuberosum] 89 5e-16 gb|AFZ78558.1| cellulose synthase [Populus tomentosa] 88 1e-15 ref|XP_002324291.1| TGACG-motif binding family protein [Populus ... 88 1e-15 gb|EPS68064.1| hypothetical protein M569_06709, partial [Genlise... 87 2e-15 gb|AEK31219.1| cellulose synthase A [Eucalyptus camaldulensis] 87 3e-15 ref|XP_006483337.1| PREDICTED: cellulose synthase A catalytic su... 86 5e-15 ref|XP_006450469.1| hypothetical protein CICLE_v10007296mg [Citr... 86 5e-15 >gb|AFB18635.1| CESA6 [Gossypium hirsutum] Length = 1083 Score = 93.2 bits (230), Expect = 3e-17 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -3 Query: 314 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 174 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSEAT+ AA GQCG+NC Sbjct: 1037 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSEATKAAANGQCGINC 1083 >gb|ACS88359.1| cellulose synthase catalytic subunit [Gossypium hirsutum] Length = 657 Score = 93.2 bits (230), Expect = 3e-17 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -3 Query: 314 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 174 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSEAT+ AA GQCG+NC Sbjct: 611 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSEATKAAANGQCGINC 657 >ref|XP_004291468.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like [Fragaria vesca subsp. vesca] Length = 1069 Score = 92.8 bits (229), Expect = 4e-17 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -3 Query: 314 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 174 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTS+AT+ AA+GQCGVNC Sbjct: 1023 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSDATKAAAKGQCGVNC 1069 >gb|EOY31461.1| Cellulose synthase 1 [Theobroma cacao] Length = 1085 Score = 92.0 bits (227), Expect = 7e-17 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -3 Query: 314 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 174 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTS+AT+ AA GQCG+NC Sbjct: 1039 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSDATKSAANGQCGINC 1085 >gb|AGC97433.2| cellulose synthase [Boehmeria nivea] Length = 1082 Score = 91.7 bits (226), Expect = 9e-17 Identities = 42/47 (89%), Positives = 46/47 (97%) Frame = -3 Query: 314 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 174 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTS+AT+ A++GQCGVNC Sbjct: 1036 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSDATKAASRGQCGVNC 1082 >gb|AAY78952.3| cellulose synthase CesA1 [Boehmeria nivea] Length = 938 Score = 91.7 bits (226), Expect = 9e-17 Identities = 42/47 (89%), Positives = 46/47 (97%) Frame = -3 Query: 314 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 174 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTS+AT+ A++GQCGVNC Sbjct: 892 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSDATKAASRGQCGVNC 938 >gb|AFZ78556.1| cellulose synthase [Populus tomentosa] Length = 1075 Score = 90.9 bits (224), Expect = 2e-16 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = -3 Query: 314 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 174 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTS++T+ AA GQCG+NC Sbjct: 1029 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSDSTKAAANGQCGINC 1075 >ref|XP_002308657.1| cellulose synthase family protein [Populus trichocarpa] gi|224143917|ref|XP_002336091.1| predicted protein [Populus trichocarpa] gi|222854633|gb|EEE92180.1| cellulose synthase family protein [Populus trichocarpa] Length = 1075 Score = 90.9 bits (224), Expect = 2e-16 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = -3 Query: 314 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 174 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTS++T+ AA GQCG+NC Sbjct: 1029 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSDSTKAAANGQCGINC 1075 >gb|AAO25536.1| cellulose synthase [Populus tremuloides] Length = 1083 Score = 90.9 bits (224), Expect = 2e-16 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = -3 Query: 314 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 174 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTS++T+ AA GQCG+NC Sbjct: 1037 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSDSTKAAANGQCGINC 1083 >gb|EMJ22782.1| hypothetical protein PRUPE_ppa000611mg [Prunus persica] Length = 1072 Score = 90.1 bits (222), Expect = 3e-16 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = -3 Query: 314 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 174 RQNRTPTIVIVWSILLASIFSLLWVRIDPFT++AT+ A+ GQCGVNC Sbjct: 1026 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTNDATKAASNGQCGVNC 1072 >ref|XP_002515536.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative [Ricinus communis] gi|223545480|gb|EEF46985.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative [Ricinus communis] Length = 1083 Score = 90.1 bits (222), Expect = 3e-16 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -3 Query: 314 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 174 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTS+A + AA GQCG+NC Sbjct: 1037 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSDAAKAAANGQCGINC 1083 >ref|XP_006361724.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] [Solanum tuberosum] Length = 1086 Score = 89.4 bits (220), Expect = 5e-16 Identities = 39/47 (82%), Positives = 46/47 (97%) Frame = -3 Query: 314 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 174 RQNRTPTIVIVW++LLASIFSLLWVRIDPFTS+A++ AA+GQCG+NC Sbjct: 1040 RQNRTPTIVIVWAVLLASIFSLLWVRIDPFTSDASKTAARGQCGINC 1086 >ref|XP_004245031.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like [Solanum lycopersicum] Length = 1086 Score = 89.4 bits (220), Expect = 5e-16 Identities = 39/47 (82%), Positives = 46/47 (97%) Frame = -3 Query: 314 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 174 RQNRTPTIVIVW++LLASIFSLLWVRIDPFTS+A++ AA+GQCG+NC Sbjct: 1040 RQNRTPTIVIVWAVLLASIFSLLWVRIDPFTSDASKTAARGQCGINC 1086 >gb|AAP97497.1| cellulose synthase [Solanum tuberosum] Length = 771 Score = 89.4 bits (220), Expect = 5e-16 Identities = 39/47 (82%), Positives = 46/47 (97%) Frame = -3 Query: 314 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 174 RQNRTPTIVIVW++LLASIFSLLWVRIDPFTS+A++ AA+GQCG+NC Sbjct: 725 RQNRTPTIVIVWAVLLASIFSLLWVRIDPFTSDASKTAARGQCGINC 771 >gb|AFZ78558.1| cellulose synthase [Populus tomentosa] Length = 1084 Score = 87.8 bits (216), Expect = 1e-15 Identities = 40/47 (85%), Positives = 42/47 (89%) Frame = -3 Query: 314 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 174 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTS T+ A GQCG+NC Sbjct: 1038 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSSTTQTTANGQCGINC 1084 >ref|XP_002324291.1| TGACG-motif binding family protein [Populus trichocarpa] gi|222865725|gb|EEF02856.1| TGACG-motif binding family protein [Populus trichocarpa] Length = 1084 Score = 87.8 bits (216), Expect = 1e-15 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = -3 Query: 314 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 174 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTS T+ A+ GQCGVNC Sbjct: 1038 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSGTTQTASNGQCGVNC 1084 >gb|EPS68064.1| hypothetical protein M569_06709, partial [Genlisea aurea] Length = 1088 Score = 87.0 bits (214), Expect = 2e-15 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = -3 Query: 314 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 174 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTS+ + AQGQCG++C Sbjct: 1042 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSQTAKSTAQGQCGISC 1088 >gb|AEK31219.1| cellulose synthase A [Eucalyptus camaldulensis] Length = 1085 Score = 86.7 bits (213), Expect = 3e-15 Identities = 40/47 (85%), Positives = 41/47 (87%) Frame = -3 Query: 314 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 174 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTS T A GQCG+NC Sbjct: 1039 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSATTTSTANGQCGINC 1085 >ref|XP_006483337.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like isoform X1 [Citrus sinensis] Length = 1102 Score = 85.9 bits (211), Expect = 5e-15 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = -3 Query: 314 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 174 RQNRTPTIVIVWSILLASIFSLLWVR+DPFTS+ T+ + GQCG+NC Sbjct: 1056 RQNRTPTIVIVWSILLASIFSLLWVRVDPFTSDDTKANSNGQCGINC 1102 >ref|XP_006450469.1| hypothetical protein CICLE_v10007296mg [Citrus clementina] gi|568859626|ref|XP_006483338.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like isoform X2 [Citrus sinensis] gi|557553695|gb|ESR63709.1| hypothetical protein CICLE_v10007296mg [Citrus clementina] Length = 1085 Score = 85.9 bits (211), Expect = 5e-15 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = -3 Query: 314 RQNRTPTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 174 RQNRTPTIVIVWSILLASIFSLLWVR+DPFTS+ T+ + GQCG+NC Sbjct: 1039 RQNRTPTIVIVWSILLASIFSLLWVRVDPFTSDDTKANSNGQCGINC 1085