BLASTX nr result
ID: Rehmannia24_contig00005851
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00005851 (326 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAE53680.1| putative glycerophosphoryl diester phosphodieste... 55 1e-05 >dbj|BAE53680.1| putative glycerophosphoryl diester phosphodiesterase family protein [Nicotiana tabacum] gi|115500890|dbj|BAF34116.1| glycerophosphodiesterase-like protein [Nicotiana tabacum] Length = 752 Score = 55.1 bits (131), Expect = 1e-05 Identities = 31/68 (45%), Positives = 41/68 (60%) Frame = +1 Query: 1 LPPAEAPSGILREDDVTXXXXXXXXXXXXXNSGNGSTAPGPTPPNGQPTLVASTILSGIA 180 LPPAEAP+ +L E DV N NGS A PTPPNGQ ++VAS ++S +A Sbjct: 686 LPPAEAPNPVLTESDVVEPPLPPVAKINPSND-NGS-AIAPTPPNGQSSVVASILMSSVA 743 Query: 181 VLLAAFVL 204 +LLA ++ Sbjct: 744 ILLATIMV 751