BLASTX nr result
ID: Rehmannia24_contig00004930
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00004930 (547 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS71012.1| hypothetical protein M569_03758, partial [Genlise... 77 4e-12 >gb|EPS71012.1| hypothetical protein M569_03758, partial [Genlisea aurea] Length = 61 Score = 76.6 bits (187), Expect = 4e-12 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = +1 Query: 388 FQEYEFSREVVGMAWIMLRIDYSRLFWLLFGVFSYENHEGKPRIF 522 +QE+ VG+ WIMLRIDYSRL WLLFGVFSYENHEGKPRIF Sbjct: 17 YQEFSRQAVAVGITWIMLRIDYSRLSWLLFGVFSYENHEGKPRIF 61