BLASTX nr result
ID: Rehmannia24_contig00004787
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00004787 (315 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004491390.1| PREDICTED: 40S ribosomal protein S29-like [C... 91 2e-16 gb|ADB02896.1| ribosomal protein S29 [Jatropha curcas] 91 2e-16 ref|XP_002263938.1| PREDICTED: 40S ribosomal protein S29-like [V... 91 2e-16 ref|XP_002271801.1| PREDICTED: 40S ribosomal protein S29-like [V... 91 2e-16 gb|AAT08693.1| ribosomal protein S29 [Hyacinthus orientalis] 91 2e-16 ref|XP_002302413.1| predicted protein [Populus trichocarpa] gi|1... 90 3e-16 gb|ABK93425.1| unknown [Populus trichocarpa] 90 3e-16 gb|EMJ24755.1| hypothetical protein PRUPE_ppa014535mg [Prunus pe... 88 1e-15 ref|XP_006347277.1| PREDICTED: 40S ribosomal protein S29-like [S... 87 2e-15 ref|XP_004250423.1| PREDICTED: 40S ribosomal protein S29-like [S... 87 2e-15 ref|NP_001066851.1| Os12g0508300 [Oryza sativa Japonica Group] g... 87 2e-15 ref|XP_002320698.2| hypothetical protein POPTR_0014s01800g [Popu... 87 3e-15 gb|ESW29209.1| hypothetical protein PHAVU_002G052200g, partial [... 86 5e-15 ref|XP_003633092.1| PREDICTED: 40S ribosomal protein S29-like is... 86 5e-15 ref|XP_002298768.2| hypothetical protein POPTR_0001s30310g [Popu... 86 7e-15 gb|AFK35122.1| unknown [Lotus japonicus] gi|508706548|gb|EOX9844... 86 7e-15 ref|XP_003610623.1| 40S ribosomal protein S29 [Medicago truncatu... 86 7e-15 ref|XP_006474714.1| PREDICTED: 40S ribosomal protein S29-like [C... 85 9e-15 ref|XP_006386480.1| hypothetical protein POPTR_0002s12040g [Popu... 85 9e-15 ref|XP_002313420.2| hypothetical protein POPTR_0009s09320g [Popu... 85 9e-15 >ref|XP_004491390.1| PREDICTED: 40S ribosomal protein S29-like [Cicer arietinum] gi|502158873|ref|XP_004511309.1| PREDICTED: 40S ribosomal protein S29-like [Cicer arietinum] Length = 56 Score = 90.5 bits (223), Expect = 2e-16 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 315 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 199 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 18 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >gb|ADB02896.1| ribosomal protein S29 [Jatropha curcas] Length = 56 Score = 90.5 bits (223), Expect = 2e-16 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 315 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 199 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 18 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_002263938.1| PREDICTED: 40S ribosomal protein S29-like [Vitis vinifera] gi|470106904|ref|XP_004289795.1| PREDICTED: 40S ribosomal protein S29-like [Fragaria vesca subsp. vesca] gi|470109340|ref|XP_004290957.1| PREDICTED: 40S ribosomal protein S29-like [Fragaria vesca subsp. vesca] gi|561016293|gb|ESW15097.1| hypothetical protein PHAVU_007G043800g [Phaseolus vulgaris] Length = 56 Score = 90.5 bits (223), Expect = 2e-16 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 315 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 199 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 18 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_002271801.1| PREDICTED: 40S ribosomal protein S29-like [Vitis vinifera] gi|225444692|ref|XP_002277856.1| PREDICTED: 40S ribosomal protein S29-like isoform 1 [Vitis vinifera] gi|255538096|ref|XP_002510113.1| 40S ribosomal protein S29, putative [Ricinus communis] gi|356497504|ref|XP_003517600.1| PREDICTED: 40S ribosomal protein S29-like [Glycine max] gi|356536119|ref|XP_003536587.1| PREDICTED: 40S ribosomal protein S29 [Glycine max] gi|356538933|ref|XP_003537955.1| PREDICTED: 40S ribosomal protein S29-like isoform 1 [Glycine max] gi|356575720|ref|XP_003555985.1| PREDICTED: 40S ribosomal protein S29-like [Glycine max] gi|449438331|ref|XP_004136942.1| PREDICTED: 40S ribosomal protein S29-like [Cucumis sativus] gi|449447053|ref|XP_004141284.1| PREDICTED: 40S ribosomal protein S29-like [Cucumis sativus] gi|449469128|ref|XP_004152273.1| PREDICTED: 40S ribosomal protein S29-like [Cucumis sativus] gi|449484349|ref|XP_004156858.1| PREDICTED: 40S ribosomal protein S29-like [Cucumis sativus] gi|449508184|ref|XP_004163243.1| PREDICTED: 40S ribosomal protein S29-like [Cucumis sativus] gi|449520128|ref|XP_004167086.1| PREDICTED: 40S ribosomal protein S29-like [Cucumis sativus] gi|223550814|gb|EEF52300.1| 40S ribosomal protein S29, putative [Ricinus communis] Length = 56 Score = 90.5 bits (223), Expect = 2e-16 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 315 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 199 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 18 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >gb|AAT08693.1| ribosomal protein S29 [Hyacinthus orientalis] Length = 73 Score = 90.5 bits (223), Expect = 2e-16 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -1 Query: 315 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 199 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 35 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 73 >ref|XP_002302413.1| predicted protein [Populus trichocarpa] gi|118482417|gb|ABK93131.1| unknown [Populus trichocarpa] Length = 56 Score = 89.7 bits (221), Expect = 3e-16 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -1 Query: 315 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 199 SRTCRVCGNPHG+IRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 18 SRTCRVCGNPHGIIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >gb|ABK93425.1| unknown [Populus trichocarpa] Length = 56 Score = 89.7 bits (221), Expect = 3e-16 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -1 Query: 315 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 199 SRTCRVCGNPHG+IRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 18 SRTCRVCGNPHGIIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >gb|EMJ24755.1| hypothetical protein PRUPE_ppa014535mg [Prunus persica] Length = 56 Score = 88.2 bits (217), Expect = 1e-15 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -1 Query: 315 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 199 SRTCRVCGNPHGLIRKY LMCCRQCFRSNAKEIGFIKYR Sbjct: 18 SRTCRVCGNPHGLIRKYALMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_006347277.1| PREDICTED: 40S ribosomal protein S29-like [Solanum tuberosum] gi|565367342|ref|XP_006350329.1| PREDICTED: 40S ribosomal protein S29-like [Solanum tuberosum] Length = 56 Score = 87.4 bits (215), Expect = 2e-15 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -1 Query: 315 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 199 SRTCRVCGNPH +IRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 18 SRTCRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_004250423.1| PREDICTED: 40S ribosomal protein S29-like [Solanum lycopersicum] Length = 56 Score = 87.4 bits (215), Expect = 2e-15 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -1 Query: 315 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 199 SRTCRVCGNPH +IRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 18 SRTCRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|NP_001066851.1| Os12g0508300 [Oryza sativa Japonica Group] gi|297722587|ref|NP_001173657.1| Os03g0773150 [Oryza sativa Japonica Group] gi|31745220|gb|AAP68880.1| putative ribosomal protein S29 [Oryza sativa Japonica Group] gi|77552059|gb|ABA94856.1| 40S ribosomal protein S29, putative, expressed [Oryza sativa Japonica Group] gi|113649358|dbj|BAF29870.1| Os12g0508300 [Oryza sativa Japonica Group] gi|125535057|gb|EAY81605.1| hypothetical protein OsI_36775 [Oryza sativa Indica Group] gi|125577778|gb|EAZ19000.1| hypothetical protein OsJ_34533 [Oryza sativa Japonica Group] gi|149391293|gb|ABR25664.1| 40S ribosomal protein S29 [Oryza sativa Indica Group] gi|255674934|dbj|BAH92385.1| Os03g0773150 [Oryza sativa Japonica Group] Length = 56 Score = 87.4 bits (215), Expect = 2e-15 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -1 Query: 315 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 199 SR CRVCGNPHGLIRKYGLMCCRQCFRSNAK+IGFIKYR Sbjct: 18 SRVCRVCGNPHGLIRKYGLMCCRQCFRSNAKDIGFIKYR 56 >ref|XP_002320698.2| hypothetical protein POPTR_0014s01800g [Populus trichocarpa] gi|550323136|gb|EEE99013.2| hypothetical protein POPTR_0014s01800g [Populus trichocarpa] Length = 90 Score = 86.7 bits (213), Expect = 3e-15 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -1 Query: 315 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 199 SRTCRVCGNPHG+IRKYGLMCCRQCFRSNAKEIGFIK R Sbjct: 18 SRTCRVCGNPHGIIRKYGLMCCRQCFRSNAKEIGFIKVR 56 >gb|ESW29209.1| hypothetical protein PHAVU_002G052200g, partial [Phaseolus vulgaris] Length = 81 Score = 85.9 bits (211), Expect = 5e-15 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 315 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIK 205 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIK Sbjct: 19 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIK 55 >ref|XP_003633092.1| PREDICTED: 40S ribosomal protein S29-like isoform 2 [Vitis vinifera] gi|297738544|emb|CBI27789.3| unnamed protein product [Vitis vinifera] Length = 73 Score = 85.9 bits (211), Expect = 5e-15 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 315 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIK 205 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIK Sbjct: 18 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIK 54 >ref|XP_002298768.2| hypothetical protein POPTR_0001s30310g [Populus trichocarpa] gi|550348537|gb|EEE83573.2| hypothetical protein POPTR_0001s30310g [Populus trichocarpa] Length = 80 Score = 85.5 bits (210), Expect = 7e-15 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -1 Query: 315 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 199 SRTCRVCGNPHG+IRKYGLMCCRQCFRSNAKEIGFIK + Sbjct: 18 SRTCRVCGNPHGIIRKYGLMCCRQCFRSNAKEIGFIKLK 56 >gb|AFK35122.1| unknown [Lotus japonicus] gi|508706548|gb|EOX98444.1| Ribosomal protein S14p/S29e family protein [Theobroma cacao] Length = 56 Score = 85.5 bits (210), Expect = 7e-15 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -1 Query: 315 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 199 SR CRVCGNPH +IRKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 18 SRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_003610623.1| 40S ribosomal protein S29 [Medicago truncatula] gi|355511958|gb|AES93581.1| 40S ribosomal protein S29 [Medicago truncatula] gi|388499804|gb|AFK37968.1| unknown [Medicago truncatula] gi|388516451|gb|AFK46287.1| unknown [Medicago truncatula] gi|388516531|gb|AFK46327.1| unknown [Medicago truncatula] gi|388518599|gb|AFK47361.1| unknown [Medicago truncatula] Length = 56 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/39 (94%), Positives = 37/39 (94%) Frame = -1 Query: 315 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 199 SRTCRVCGN HGLIRKYGLMCCRQCF SNAKEIGFIKYR Sbjct: 18 SRTCRVCGNSHGLIRKYGLMCCRQCFHSNAKEIGFIKYR 56 >ref|XP_006474714.1| PREDICTED: 40S ribosomal protein S29-like [Citrus sinensis] gi|568867204|ref|XP_006486933.1| PREDICTED: 40S ribosomal protein S29-like [Citrus sinensis] Length = 56 Score = 85.1 bits (209), Expect = 9e-15 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 315 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR 199 SR CRVCGNPH +IRKYGLMCCRQCFRSNAKEIGF+KYR Sbjct: 18 SRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFVKYR 56 >ref|XP_006386480.1| hypothetical protein POPTR_0002s12040g [Populus trichocarpa] gi|550344828|gb|ERP64277.1| hypothetical protein POPTR_0002s12040g [Populus trichocarpa] Length = 100 Score = 85.1 bits (209), Expect = 9e-15 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 315 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIK 205 SRTCRVCGNPHG+IRKYGLMCCRQCFRSNAKEIGFIK Sbjct: 18 SRTCRVCGNPHGIIRKYGLMCCRQCFRSNAKEIGFIK 54 >ref|XP_002313420.2| hypothetical protein POPTR_0009s09320g [Populus trichocarpa] gi|550331371|gb|EEE87375.2| hypothetical protein POPTR_0009s09320g [Populus trichocarpa] Length = 57 Score = 85.1 bits (209), Expect = 9e-15 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 315 SRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIK 205 SRTCRVCGNPHG+IRKYGLMCCRQCFRSNAKEIGFIK Sbjct: 18 SRTCRVCGNPHGIIRKYGLMCCRQCFRSNAKEIGFIK 54