BLASTX nr result
ID: Rehmannia24_contig00004753
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00004753 (439 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006356506.1| PREDICTED: patellin-2-like [Solanum tuberosum] 65 9e-09 ref|XP_006384383.1| hypothetical protein POPTR_0004s14530g [Popu... 65 9e-09 ref|XP_004241867.1| PREDICTED: patellin-5-like [Solanum lycopers... 65 9e-09 ref|XP_004173579.1| PREDICTED: patellin-3-like, partial [Cucumis... 65 9e-09 ref|XP_004146380.1| PREDICTED: patellin-3-like [Cucumis sativus] 65 9e-09 ref|XP_002330469.1| predicted protein [Populus trichocarpa] 65 9e-09 ref|XP_006473247.1| PREDICTED: patellin-2-like [Citrus sinensis] 64 2e-08 ref|XP_006434672.1| hypothetical protein CICLE_v10000682mg [Citr... 64 2e-08 gb|EPS65885.1| hypothetical protein M569_08890, partial [Genlise... 63 4e-08 ref|XP_004250845.1| PREDICTED: patellin-5-like [Solanum lycopers... 63 5e-08 ref|XP_006339369.1| PREDICTED: patellin-2-like [Solanum tuberosum] 62 6e-08 ref|XP_002325736.2| hypothetical protein POPTR_0019s00780g [Popu... 62 8e-08 ref|XP_006387528.1| hypothetical protein POPTR_0895s00200g [Popu... 62 8e-08 ref|XP_002521801.1| Patellin-3, putative [Ricinus communis] gi|2... 62 8e-08 ref|XP_002525405.1| Patellin-3, putative [Ricinus communis] gi|2... 61 1e-07 ref|XP_006466197.1| PREDICTED: patellin-3-like [Citrus sinensis] 61 2e-07 ref|XP_006426421.1| hypothetical protein CICLE_v10025217mg [Citr... 61 2e-07 ref|XP_004299816.1| PREDICTED: patellin-3-like [Fragaria vesca s... 61 2e-07 dbj|BAE71201.1| putative cytosolic factor [Trifolium pratense] 60 3e-07 gb|EMJ25985.1| hypothetical protein PRUPE_ppa023884mg, partial [... 59 5e-07 >ref|XP_006356506.1| PREDICTED: patellin-2-like [Solanum tuberosum] Length = 577 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = +2 Query: 197 SFKEESNKVDDLIDPEKKALDEFKQLIQEALNKHEFTA 310 SFKEESNKV++L +PE+KAL EFKQ++QEALNKHEFTA Sbjct: 64 SFKEESNKVEELPNPEQKALAEFKQMVQEALNKHEFTA 101 >ref|XP_006384383.1| hypothetical protein POPTR_0004s14530g [Populus trichocarpa] gi|550340999|gb|ERP62180.1| hypothetical protein POPTR_0004s14530g [Populus trichocarpa] Length = 583 Score = 65.1 bits (157), Expect = 9e-09 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +2 Query: 197 SFKEESNKVDDLIDPEKKALDEFKQLIQEALNKHEFTA 310 SFKEES KV DL+D EKKAL EFKQL+QEALNKHEF+A Sbjct: 76 SFKEESTKVADLLDSEKKALQEFKQLVQEALNKHEFSA 113 >ref|XP_004241867.1| PREDICTED: patellin-5-like [Solanum lycopersicum] Length = 580 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = +2 Query: 197 SFKEESNKVDDLIDPEKKALDEFKQLIQEALNKHEFTA 310 SFKEESNKV++L +PE+KAL EFKQ++QEALNKHEFTA Sbjct: 65 SFKEESNKVEELPNPEQKALAEFKQMVQEALNKHEFTA 102 >ref|XP_004173579.1| PREDICTED: patellin-3-like, partial [Cucumis sativus] Length = 468 Score = 65.1 bits (157), Expect = 9e-09 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +2 Query: 197 SFKEESNKVDDLIDPEKKALDEFKQLIQEALNKHEFTA 310 SFKEES KV DL D EKKAL+EFKQLIQEALNKHEFT+ Sbjct: 62 SFKEESTKVADLSDSEKKALEEFKQLIQEALNKHEFTS 99 >ref|XP_004146380.1| PREDICTED: patellin-3-like [Cucumis sativus] Length = 568 Score = 65.1 bits (157), Expect = 9e-09 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +2 Query: 197 SFKEESNKVDDLIDPEKKALDEFKQLIQEALNKHEFTA 310 SFKEES KV DL D EKKAL+EFKQLIQEALNKHEFT+ Sbjct: 62 SFKEESTKVADLSDSEKKALEEFKQLIQEALNKHEFTS 99 >ref|XP_002330469.1| predicted protein [Populus trichocarpa] Length = 513 Score = 65.1 bits (157), Expect = 9e-09 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +2 Query: 197 SFKEESNKVDDLIDPEKKALDEFKQLIQEALNKHEFTA 310 SFKEES KV DL+D EKKAL EFKQL+QEALNKHEF+A Sbjct: 6 SFKEESTKVADLLDSEKKALQEFKQLVQEALNKHEFSA 43 >ref|XP_006473247.1| PREDICTED: patellin-2-like [Citrus sinensis] Length = 580 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +2 Query: 197 SFKEESNKVDDLIDPEKKALDEFKQLIQEALNKHEFTA 310 SFKEESN V +L DP+KKALDE KQLIQ+ALNKHEFTA Sbjct: 73 SFKEESNVVGELPDPQKKALDELKQLIQDALNKHEFTA 110 >ref|XP_006434672.1| hypothetical protein CICLE_v10000682mg [Citrus clementina] gi|557536794|gb|ESR47912.1| hypothetical protein CICLE_v10000682mg [Citrus clementina] Length = 582 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +2 Query: 197 SFKEESNKVDDLIDPEKKALDEFKQLIQEALNKHEFTA 310 SFKEESN V +L DP+KKALDE KQLIQ+ALNKHEFTA Sbjct: 72 SFKEESNVVGELPDPQKKALDELKQLIQDALNKHEFTA 109 >gb|EPS65885.1| hypothetical protein M569_08890, partial [Genlisea aurea] Length = 554 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +2 Query: 197 SFKEESNKVDDLIDPEKKALDEFKQLIQEALNKHEFT 307 SFKEESNK++DL+DPEKKALDE K LIQEAL+K EF+ Sbjct: 70 SFKEESNKIEDLVDPEKKALDELKLLIQEALDKREFS 106 >ref|XP_004250845.1| PREDICTED: patellin-5-like [Solanum lycopersicum] Length = 589 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = +2 Query: 197 SFKEESNKVDDLIDPEKKALDEFKQLIQEALNKHEFTA 310 SFKEESNKVD+L +PE+KAL E K+L+Q+ALNKHEFTA Sbjct: 65 SFKEESNKVDELPNPEQKALAELKELVQDALNKHEFTA 102 >ref|XP_006339369.1| PREDICTED: patellin-2-like [Solanum tuberosum] Length = 616 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = +2 Query: 197 SFKEESNKVDDLIDPEKKALDEFKQLIQEALNKHEFTA 310 SFKEESNKV++L +PE+KAL E KQL+Q+ALNKHEFTA Sbjct: 73 SFKEESNKVEELPNPEQKALAELKQLVQDALNKHEFTA 110 >ref|XP_002325736.2| hypothetical protein POPTR_0019s00780g [Populus trichocarpa] gi|550316402|gb|EEF00118.2| hypothetical protein POPTR_0019s00780g [Populus trichocarpa] Length = 605 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +2 Query: 197 SFKEESNKVDDLIDPEKKALDEFKQLIQEALNKHEFTA 310 SFKEES KV DL++ EKKAL EFK+L+QEALNKHEF+A Sbjct: 81 SFKEESTKVADLLESEKKALQEFKKLVQEALNKHEFSA 118 >ref|XP_006387528.1| hypothetical protein POPTR_0895s00200g [Populus trichocarpa] gi|550307482|gb|ERP46442.1| hypothetical protein POPTR_0895s00200g [Populus trichocarpa] Length = 605 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +2 Query: 197 SFKEESNKVDDLIDPEKKALDEFKQLIQEALNKHEFTA 310 SFKEES KV DL++ EKKAL EFK+L+QEALNKHEF+A Sbjct: 81 SFKEESTKVADLLESEKKALQEFKKLVQEALNKHEFSA 118 >ref|XP_002521801.1| Patellin-3, putative [Ricinus communis] gi|223539014|gb|EEF40611.1| Patellin-3, putative [Ricinus communis] Length = 627 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +2 Query: 197 SFKEESNKVDDLIDPEKKALDEFKQLIQEALNKHEFTA 310 SFKEE+N V +L + +KKALDEFKQLIQEALNKHEFTA Sbjct: 87 SFKEETNVVGELPEAQKKALDEFKQLIQEALNKHEFTA 124 >ref|XP_002525405.1| Patellin-3, putative [Ricinus communis] gi|223535296|gb|EEF36972.1| Patellin-3, putative [Ricinus communis] Length = 606 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +2 Query: 197 SFKEESNKVDDLIDPEKKALDEFKQLIQEALNKHEFT 307 SFKEES KV DL+D EKKA++E +QL+QEALNKHEFT Sbjct: 94 SFKEESTKVADLLDSEKKAVEELRQLVQEALNKHEFT 130 >ref|XP_006466197.1| PREDICTED: patellin-3-like [Citrus sinensis] Length = 594 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +2 Query: 197 SFKEESNKVDDLIDPEKKALDEFKQLIQEALNKHEFTA 310 SFKEES +V DL D EKKALDE KQ++QEALNKHEF+A Sbjct: 79 SFKEESTRVGDLPDNEKKALDELKQVVQEALNKHEFSA 116 >ref|XP_006426421.1| hypothetical protein CICLE_v10025217mg [Citrus clementina] gi|557528411|gb|ESR39661.1| hypothetical protein CICLE_v10025217mg [Citrus clementina] Length = 596 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +2 Query: 197 SFKEESNKVDDLIDPEKKALDEFKQLIQEALNKHEFTA 310 SFKEES +V DL D EKKALDE KQ++QEALNKHEF+A Sbjct: 79 SFKEESTRVGDLPDNEKKALDELKQVVQEALNKHEFSA 116 >ref|XP_004299816.1| PREDICTED: patellin-3-like [Fragaria vesca subsp. vesca] Length = 603 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +2 Query: 197 SFKEESNKVDDLIDPEKKALDEFKQLIQEALNKHEFTA 310 SFKEES V +L +P+KKALDE KQLIQEALNKHEFTA Sbjct: 73 SFKEESYVVGELPEPQKKALDELKQLIQEALNKHEFTA 110 >dbj|BAE71201.1| putative cytosolic factor [Trifolium pratense] Length = 607 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +2 Query: 197 SFKEESNKVDDLIDPEKKALDEFKQLIQEALNKHEFTA 310 SFKEE+N V +L + +KKALDE KQLIQEALNKHEFTA Sbjct: 79 SFKEETNVVSELPESQKKALDELKQLIQEALNKHEFTA 116 >gb|EMJ25985.1| hypothetical protein PRUPE_ppa023884mg, partial [Prunus persica] Length = 584 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +2 Query: 197 SFKEESNKVDDLIDPEKKALDEFKQLIQEALNKHEFTA 310 SFKEES V +L +P+KKAL+E KQLIQEALNKHEFTA Sbjct: 42 SFKEESYVVGELPEPQKKALEELKQLIQEALNKHEFTA 79