BLASTX nr result
ID: Rehmannia24_contig00004723
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00004723 (475 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS67091.1| hypothetical protein M569_07684, partial [Genlise... 75 1e-11 >gb|EPS67091.1| hypothetical protein M569_07684, partial [Genlisea aurea] Length = 1159 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/50 (70%), Positives = 40/50 (80%) Frame = -1 Query: 151 MESPERGRPVPGIAMEFPVSDGVLSCSPPTMPPWLRRRLSEPKTPPPSTV 2 MESP+R PV +MEFP +DGV SCSPPT+P WLRRRLS PKTP P+TV Sbjct: 1 MESPDRDPPV---SMEFPANDGVFSCSPPTIPSWLRRRLSGPKTPSPTTV 47