BLASTX nr result
ID: Rehmannia24_contig00004436
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00004436 (688 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002869331.1| hypothetical protein ARALYDRAFT_913334 [Arab... 54 4e-06 >ref|XP_002869331.1| hypothetical protein ARALYDRAFT_913334 [Arabidopsis lyrata subsp. lyrata] gi|297315167|gb|EFH45590.1| hypothetical protein ARALYDRAFT_913334 [Arabidopsis lyrata subsp. lyrata] Length = 179 Score = 53.9 bits (128), Expect(2) = 4e-06 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = +2 Query: 119 GCFEIRE*GGDIFVSLLDMEKPFAAIKALDMKVVI 223 GCFEIRE GG+ F+SLL+M++PFA +KALDM+ VI Sbjct: 137 GCFEIREEGGETFISLLEMKRPFAPMKALDMEEVI 171 Score = 23.5 bits (49), Expect(2) = 4e-06 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +3 Query: 39 RAIQFKDDLEKRVSGVNM 92 RAIQ K+ LE V GVN+ Sbjct: 110 RAIQVKEGLEGAVPGVNV 127