BLASTX nr result
ID: Rehmannia24_contig00002471
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00002471 (792 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB82585.1| hypothetical protein L484_027763 [Morus notabilis] 57 1e-05 >gb|EXB82585.1| hypothetical protein L484_027763 [Morus notabilis] Length = 191 Score = 56.6 bits (135), Expect = 1e-05 Identities = 40/105 (38%), Positives = 55/105 (52%), Gaps = 7/105 (6%) Frame = +1 Query: 160 VYQNPVMTRQPDNSH-SNGSFGPXXXXXXXXXXXXXXXXXLGRLCSRRHHRAK---EGSH 327 VY NPV + P +SH SNGSFG LGRLC+RR H K + SH Sbjct: 23 VYPNPVTKQPPGSSHHSNGSFGTVFIILAVIAVVSAIACLLGRLCNRRVHSQKPKAQTSH 82 Query: 328 KPPKASKQSQGLGPKEW--ESRQKPSFNMRD-GDIEFGFDKKIPS 453 KP +++++ + E+ +S Q +F RD GD+EFG + I S Sbjct: 83 KPSRSTRKDRLDHHVEFGSDSGQNNNFRPRDQGDVEFGNNPNINS 127