BLASTX nr result
ID: Rehmannia24_contig00002428
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00002428 (400 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS61646.1| hypothetical protein M569_13153, partial [Genlise... 64 2e-08 >gb|EPS61646.1| hypothetical protein M569_13153, partial [Genlisea aurea] Length = 92 Score = 63.9 bits (154), Expect = 2e-08 Identities = 36/74 (48%), Positives = 41/74 (55%) Frame = +3 Query: 177 FLGKRFFP*RLGFMSRNQSRAERSESIQYRKTGRSGNSNQPRQFPSGVSTKXXXXXXXXX 356 F G RF LGFMS NQSR SE YRKT RSGNSNQ RQ+ G+++K Sbjct: 1 FFGNRFCHPTLGFMSHNQSR---SEPTHYRKTTRSGNSNQQRQYQGGIASKGGGGASSAT 57 Query: 357 XXXXXRSFKKYNNN 398 RSFKKY + Sbjct: 58 SNSGSRSFKKYGGS 71