BLASTX nr result
ID: Rehmannia24_contig00002133
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00002133 (410 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI14900.3| unnamed protein product [Vitis vinifera] 81 1e-13 ref|XP_002278192.1| PREDICTED: BTB/POZ and TAZ domain-containing... 81 1e-13 ref|XP_002511276.1| protein binding protein, putative [Ricinus c... 80 3e-13 ref|XP_002322214.2| speckle-type POZ family protein [Populus tri... 76 5e-12 ref|XP_006376888.1| hypothetical protein POPTR_0012s09300g [Popu... 75 9e-12 ref|XP_006387987.1| speckle-type POZ family protein [Populus tri... 75 9e-12 ref|XP_002318693.1| predicted protein [Populus trichocarpa] 75 9e-12 gb|EOY22321.1| BTB and TAZ domain protein 2 isoform 3, partial [... 74 3e-11 gb|EOY22320.1| BTB and TAZ domain protein 2 isoform 2 [Theobroma... 74 3e-11 gb|EOY22319.1| BTB and TAZ domain protein 2 isoform 1 [Theobroma... 74 3e-11 ref|XP_003549831.2| PREDICTED: BTB/POZ and TAZ domain-containing... 72 8e-11 gb|EMJ10388.1| hypothetical protein PRUPE_ppa006416mg [Prunus pe... 72 8e-11 ref|XP_006347421.1| PREDICTED: BTB/POZ and TAZ domain-containing... 71 1e-10 ref|XP_004241527.1| PREDICTED: BTB/POZ and TAZ domain-containing... 71 1e-10 ref|XP_006439990.1| hypothetical protein CICLE_v10020762mg [Citr... 69 5e-10 ref|XP_006476936.1| PREDICTED: BTB/POZ and TAZ domain-containing... 69 7e-10 ref|XP_006351442.1| PREDICTED: BTB/POZ and TAZ domain-containing... 69 7e-10 ref|XP_004515848.1| PREDICTED: BTB/POZ and TAZ domain-containing... 69 9e-10 ref|XP_004299170.1| PREDICTED: BTB/POZ and TAZ domain-containing... 67 2e-09 ref|XP_006580649.1| PREDICTED: BTB/POZ and TAZ domain-containing... 67 2e-09 >emb|CBI14900.3| unnamed protein product [Vitis vinifera] Length = 347 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/48 (79%), Positives = 45/48 (93%) Frame = +3 Query: 3 LCRQFKLKAQHDRRGNNARWRLLVRKVVSARAMSSLSLPKRRREEQPR 146 LCRQFKLKAQ ++G +ARW+LLVRKVVSA+AMSSLSLPKR+REE+PR Sbjct: 286 LCRQFKLKAQQVKKGEDARWKLLVRKVVSAKAMSSLSLPKRKREEEPR 333 >ref|XP_002278192.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Vitis vinifera] Length = 351 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/48 (79%), Positives = 45/48 (93%) Frame = +3 Query: 3 LCRQFKLKAQHDRRGNNARWRLLVRKVVSARAMSSLSLPKRRREEQPR 146 LCRQFKLKAQ ++G +ARW+LLVRKVVSA+AMSSLSLPKR+REE+PR Sbjct: 290 LCRQFKLKAQQVKKGEDARWKLLVRKVVSAKAMSSLSLPKRKREEEPR 337 >ref|XP_002511276.1| protein binding protein, putative [Ricinus communis] gi|223550391|gb|EEF51878.1| protein binding protein, putative [Ricinus communis] Length = 363 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/56 (66%), Positives = 48/56 (85%) Frame = +3 Query: 3 LCRQFKLKAQHDRRGNNARWRLLVRKVVSARAMSSLSLPKRRREEQPRVAMHNLAI 170 LCRQFKLK QH+++G++A W+LLVRKVVSAR +SSLSLPKR+REEQ + +H+ I Sbjct: 303 LCRQFKLKMQHEKKGDDALWKLLVRKVVSARVLSSLSLPKRKREEQLKETIHDHGI 358 >ref|XP_002322214.2| speckle-type POZ family protein [Populus trichocarpa] gi|550322402|gb|EEF06341.2| speckle-type POZ family protein [Populus trichocarpa] Length = 360 Score = 75.9 bits (185), Expect = 5e-12 Identities = 40/61 (65%), Positives = 47/61 (77%) Frame = +3 Query: 3 LCRQFKLKAQHDRRGNNARWRLLVRKVVSARAMSSLSLPKRRREEQPRVAMHNLAI*NYV 182 LCRQFKLK Q +++G WRLLV+KV SARAMSSLSLPKR+REE PR MH+ I N+ Sbjct: 301 LCRQFKLKMQLEKKGVETLWRLLVKKVASARAMSSLSLPKRKREE-PRETMHDHGIRNFR 359 Query: 183 L 185 L Sbjct: 360 L 360 >ref|XP_006376888.1| hypothetical protein POPTR_0012s09300g [Populus trichocarpa] gi|550326732|gb|ERP54685.1| hypothetical protein POPTR_0012s09300g [Populus trichocarpa] Length = 364 Score = 75.1 bits (183), Expect = 9e-12 Identities = 38/59 (64%), Positives = 45/59 (76%) Frame = +3 Query: 3 LCRQFKLKAQHDRRGNNARWRLLVRKVVSARAMSSLSLPKRRREEQPRVAMHNLAI*NY 179 LCRQFKLK Q +RRG+ W LLV+KV SAR MSSLSLPKR+REE PR +H+ I N+ Sbjct: 305 LCRQFKLKMQRERRGDETLWSLLVKKVASARVMSSLSLPKRKREE-PRETIHDHGIRNF 362 >ref|XP_006387987.1| speckle-type POZ family protein [Populus trichocarpa] gi|550309139|gb|ERP46901.1| speckle-type POZ family protein [Populus trichocarpa] Length = 364 Score = 75.1 bits (183), Expect = 9e-12 Identities = 38/59 (64%), Positives = 45/59 (76%) Frame = +3 Query: 3 LCRQFKLKAQHDRRGNNARWRLLVRKVVSARAMSSLSLPKRRREEQPRVAMHNLAI*NY 179 LCRQFKLK Q +RRG+ W LLV+KV SAR MSSLSLPKR+REE PR +H+ I N+ Sbjct: 305 LCRQFKLKMQRERRGDETLWSLLVKKVASARVMSSLSLPKRKREE-PRETIHDHGIRNF 362 >ref|XP_002318693.1| predicted protein [Populus trichocarpa] Length = 364 Score = 75.1 bits (183), Expect = 9e-12 Identities = 38/59 (64%), Positives = 45/59 (76%) Frame = +3 Query: 3 LCRQFKLKAQHDRRGNNARWRLLVRKVVSARAMSSLSLPKRRREEQPRVAMHNLAI*NY 179 LCRQFKLK Q +RRG+ W LLV+KV SAR MSSLSLPKR+REE PR +H+ I N+ Sbjct: 305 LCRQFKLKMQRERRGDETLWSLLVKKVASARVMSSLSLPKRKREE-PRETIHDHGIRNF 362 >gb|EOY22321.1| BTB and TAZ domain protein 2 isoform 3, partial [Theobroma cacao] Length = 253 Score = 73.6 bits (179), Expect = 3e-11 Identities = 36/56 (64%), Positives = 45/56 (80%) Frame = +3 Query: 3 LCRQFKLKAQHDRRGNNARWRLLVRKVVSARAMSSLSLPKRRREEQPRVAMHNLAI 170 LCRQFKLKAQ R G++A W+LLVRKV+SA+ +SSLSLPKR+REE+ R M A+ Sbjct: 192 LCRQFKLKAQQQRMGDDALWKLLVRKVLSAKTISSLSLPKRKREEELRETMGGHAL 247 >gb|EOY22320.1| BTB and TAZ domain protein 2 isoform 2 [Theobroma cacao] Length = 334 Score = 73.6 bits (179), Expect = 3e-11 Identities = 36/56 (64%), Positives = 45/56 (80%) Frame = +3 Query: 3 LCRQFKLKAQHDRRGNNARWRLLVRKVVSARAMSSLSLPKRRREEQPRVAMHNLAI 170 LCRQFKLKAQ R G++A W+LLVRKV+SA+ +SSLSLPKR+REE+ R M A+ Sbjct: 273 LCRQFKLKAQQQRMGDDALWKLLVRKVLSAKTISSLSLPKRKREEELRETMGGHAL 328 >gb|EOY22319.1| BTB and TAZ domain protein 2 isoform 1 [Theobroma cacao] Length = 354 Score = 73.6 bits (179), Expect = 3e-11 Identities = 36/56 (64%), Positives = 45/56 (80%) Frame = +3 Query: 3 LCRQFKLKAQHDRRGNNARWRLLVRKVVSARAMSSLSLPKRRREEQPRVAMHNLAI 170 LCRQFKLKAQ R G++A W+LLVRKV+SA+ +SSLSLPKR+REE+ R M A+ Sbjct: 293 LCRQFKLKAQQQRMGDDALWKLLVRKVLSAKTISSLSLPKRKREEELRETMGGHAL 348 >ref|XP_003549831.2| PREDICTED: BTB/POZ and TAZ domain-containing protein 1 [Glycine max] Length = 396 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/60 (55%), Positives = 47/60 (78%) Frame = +3 Query: 6 CRQFKLKAQHDRRGNNARWRLLVRKVVSARAMSSLSLPKRRREEQPRVAMHNLAI*NYVL 185 CRQF+L+ Q ++R ++A+W+LL RKV SA+ MSSLSLPKR+R+E+ RV M N I ++ L Sbjct: 336 CRQFQLRMQQEKRKDDAKWKLLARKVASAKVMSSLSLPKRKRDEETRVTMDNPGIRSFKL 395 >gb|EMJ10388.1| hypothetical protein PRUPE_ppa006416mg [Prunus persica] Length = 413 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/46 (71%), Positives = 42/46 (91%) Frame = +3 Query: 3 LCRQFKLKAQHDRRGNNARWRLLVRKVVSARAMSSLSLPKRRREEQ 140 LCRQFKLK Q +++ ++ARW+LLVRKVVSAR +SSLSLPKR+REE+ Sbjct: 353 LCRQFKLKMQQEKKKDDARWKLLVRKVVSARTISSLSLPKRKREEE 398 >ref|XP_006347421.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Solanum tuberosum] Length = 349 Score = 71.2 bits (173), Expect = 1e-10 Identities = 36/61 (59%), Positives = 49/61 (80%) Frame = +3 Query: 3 LCRQFKLKAQHDRRGNNARWRLLVRKVVSARAMSSLSLPKRRREEQPRVAMHNLAI*NYV 182 LCRQFKLK Q ++G++ W+ LVRKVVSARAMSSLSLPKR+REE+P++ + + + N+ Sbjct: 289 LCRQFKLKVQ--QKGDDELWKSLVRKVVSARAMSSLSLPKRKREEEPKMDLSHPQVMNFR 346 Query: 183 L 185 L Sbjct: 347 L 347 >ref|XP_004241527.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 2-like [Solanum lycopersicum] Length = 349 Score = 71.2 bits (173), Expect = 1e-10 Identities = 36/61 (59%), Positives = 49/61 (80%) Frame = +3 Query: 3 LCRQFKLKAQHDRRGNNARWRLLVRKVVSARAMSSLSLPKRRREEQPRVAMHNLAI*NYV 182 LCRQFKLK Q ++G++ W+ LVRKVVSARAMSSLSLPKR+REE+P++ ++ + N+ Sbjct: 289 LCRQFKLKVQ--QKGDDELWKSLVRKVVSARAMSSLSLPKRKREEEPKMDFNHHQVMNFR 346 Query: 183 L 185 L Sbjct: 347 L 347 >ref|XP_006439990.1| hypothetical protein CICLE_v10020762mg [Citrus clementina] gi|557542252|gb|ESR53230.1| hypothetical protein CICLE_v10020762mg [Citrus clementina] Length = 363 Score = 69.3 bits (168), Expect = 5e-10 Identities = 34/61 (55%), Positives = 48/61 (78%) Frame = +3 Query: 3 LCRQFKLKAQHDRRGNNARWRLLVRKVVSARAMSSLSLPKRRREEQPRVAMHNLAI*NYV 182 LCRQFKLKAQ +++G++ RWRLLV+KVVSA+ +SSLS KR+R E+ R M + +I ++ Sbjct: 303 LCRQFKLKAQLEKKGDDGRWRLLVKKVVSAKTISSLSQQKRKRMEESRGTMGDYSIRSFK 362 Query: 183 L 185 L Sbjct: 363 L 363 >ref|XP_006476936.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Citrus sinensis] Length = 363 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/61 (54%), Positives = 48/61 (78%) Frame = +3 Query: 3 LCRQFKLKAQHDRRGNNARWRLLVRKVVSARAMSSLSLPKRRREEQPRVAMHNLAI*NYV 182 LCRQFKLKAQ +++G++ RWRLLV+KVVSA+ +SSLS KR+R E+ R + + +I ++ Sbjct: 303 LCRQFKLKAQQEKKGDDGRWRLLVKKVVSAKTISSLSQQKRKRMEESRGTVGDYSIRSFK 362 Query: 183 L 185 L Sbjct: 363 L 363 >ref|XP_006351442.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Solanum tuberosum] Length = 345 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/53 (62%), Positives = 44/53 (83%) Frame = +3 Query: 3 LCRQFKLKAQHDRRGNNARWRLLVRKVVSARAMSSLSLPKRRREEQPRVAMHN 161 LCRQFK K Q R+G++ W+ LV KVVSARA+SSLSLPKR+REE+P++ +H+ Sbjct: 283 LCRQFKEKVQ--RKGDDGLWKSLVEKVVSARALSSLSLPKRKREEEPKMNLHH 333 >ref|XP_004515848.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 2-like [Cicer arietinum] Length = 363 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/56 (55%), Positives = 44/56 (78%) Frame = +3 Query: 3 LCRQFKLKAQHDRRGNNARWRLLVRKVVSARAMSSLSLPKRRREEQPRVAMHNLAI 170 LCRQF+LK + ++R ++ +W+LL RKV SA+ M SLSLPKR+R+E+ RVA+ N I Sbjct: 288 LCRQFQLKMEQEKRKDDPKWKLLARKVASAKVMFSLSLPKRKRDEEMRVAIDNQGI 343 >ref|XP_004299170.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Fragaria vesca subsp. vesca] Length = 365 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/45 (68%), Positives = 41/45 (91%) Frame = +3 Query: 3 LCRQFKLKAQHDRRGNNARWRLLVRKVVSARAMSSLSLPKRRREE 137 LCRQFKLK H+++ ++ARW+LLVRKVVSA+A+SSL+L KR+REE Sbjct: 301 LCRQFKLKMIHEKKRDDARWKLLVRKVVSAKAISSLALAKRKREE 345 >ref|XP_006580649.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Glycine max] Length = 310 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/59 (52%), Positives = 47/59 (79%) Frame = +3 Query: 9 RQFKLKAQHDRRGNNARWRLLVRKVVSARAMSSLSLPKRRREEQPRVAMHNLAI*NYVL 185 RQF+L+ Q ++R ++A+W+LL RKV SA+ MSSLSLPKR+R+E+ RV ++N I ++ L Sbjct: 251 RQFQLRMQQEKRKDDAKWKLLARKVASAKVMSSLSLPKRKRDEETRVNINNPGIRSFKL 309