BLASTX nr result
ID: Rehmannia23_contig00032737
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00032737 (387 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA22099.1| ORF14 [Agrobacterium rhizogenes] 61 1e-07 ref|NP_066600.1| riorf19 [Agrobacterium rhizogenes] gi|499202669... 60 3e-07 emb|CAB65899.1| hypotethical protein, homologous to ORF14 of pRi... 59 7e-07 gb|ABI54193.1| hypothetical protein [Catharanthus roseus] gi|148... 59 7e-07 gb|ABS11828.1| hypothetical protein [Agrobacterium rhizogenes] g... 59 7e-07 prf||2009229G rolC downstream ORF 14 55 1e-05 >gb|AAA22099.1| ORF14 [Agrobacterium rhizogenes] Length = 184 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -2 Query: 386 FDVFTRQRQPQDQSDLSFKYDEVLCAGKSVF 294 FDVFTRQRQPQDQSD+ FKY+E++CAGKSVF Sbjct: 154 FDVFTRQRQPQDQSDMFFKYEEIVCAGKSVF 184 >ref|NP_066600.1| riorf19 [Agrobacterium rhizogenes] gi|499202669|ref|WP_010900209.1| hypothetical protein [Agrobacterium rhizogenes] gi|2440231|dbj|BAA22339.1| unnamed protein product [Agrobacterium rhizogenes] gi|10567329|dbj|BAB16138.1| riorf19 [Agrobacterium rhizogenes] Length = 188 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -2 Query: 386 FDVFTRQRQPQDQSDLSFKYDEVLCAGKSVF 294 FDVFTRQRQP+DQSD+ FKY+E++CAGKSVF Sbjct: 158 FDVFTRQRQPEDQSDMFFKYEEIVCAGKSVF 188 >emb|CAB65899.1| hypotethical protein, homologous to ORF14 of pRiA4 [Agrobacterium rhizogenes] Length = 188 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = -2 Query: 386 FDVFTRQRQPQDQSDLSFKYDEVLCAGKSVF 294 FDVFTRQRQP+DQSD+ FKY+E++CAGKS+F Sbjct: 157 FDVFTRQRQPEDQSDMFFKYEEIVCAGKSLF 187 >gb|ABI54193.1| hypothetical protein [Catharanthus roseus] gi|148912034|gb|ABR18545.1| hypothetical protein [Catharanthus roseus] Length = 185 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 386 FDVFTRQRQPQDQSDLSFKYDEVLCAGKSVF 294 FDVFTRQRQPQDQSD+ FKY+ V+CAGKSVF Sbjct: 154 FDVFTRQRQPQDQSDMFFKYEGVVCAGKSVF 184 >gb|ABS11828.1| hypothetical protein [Agrobacterium rhizogenes] gi|374085814|gb|AEY82386.1| hypothetical protein [Agrobacterium rhizogenes] Length = 188 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = -2 Query: 386 FDVFTRQRQPQDQSDLSFKYDEVLCAGKSVF 294 FDVFTRQRQP+DQSD+ FKY+E++CAGKS+F Sbjct: 157 FDVFTRQRQPEDQSDMFFKYEEIVCAGKSLF 187 >prf||2009229G rolC downstream ORF 14 Length = 188 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -2 Query: 386 FDVFTRQRQPQDQSDLSFKYDEVLCAGKSVF 294 FDVFTRQR +DQSD+ FKY+E++CAGKSVF Sbjct: 158 FDVFTRQRHAEDQSDMFFKYEEIVCAGKSVF 188