BLASTX nr result
ID: Rehmannia23_contig00032588
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00032588 (358 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006359105.1| PREDICTED: uncharacterized protein LOC102581... 103 3e-20 gb|EMJ12132.1| hypothetical protein PRUPE_ppa025679mg [Prunus pe... 102 4e-20 ref|XP_002323146.1| predicted protein [Populus trichocarpa] 102 4e-20 ref|XP_006370558.1| hypothetical protein POPTR_0001s437701g, par... 102 5e-20 ref|XP_002334646.1| predicted protein [Populus trichocarpa] 102 5e-20 ref|XP_006371784.1| hypothetical protein POPTR_0018s03280g, part... 102 7e-20 gb|ADN33758.1| retrotransposon protein putative ty3-gypsy sub-cl... 102 7e-20 gb|EMJ00639.1| hypothetical protein PRUPE_ppa026673mg [Prunus pe... 101 9e-20 gb|EMJ09426.1| hypothetical protein PRUPE_ppa018422mg, partial [... 99 4e-19 ref|XP_002314375.1| predicted protein [Populus trichocarpa] 99 8e-19 emb|CAN70888.1| hypothetical protein VITISV_005593 [Vitis vinifera] 98 1e-18 gb|ADN34247.1| ty3-gypsy retrotransposon protein [Cucumis melo s... 98 1e-18 gb|EMJ02808.1| hypothetical protein PRUPE_ppa019755mg [Prunus pe... 97 3e-18 ref|XP_002333404.1| predicted protein [Populus trichocarpa] 97 3e-18 gb|ADN33709.1| retrotransposon gag protein [Cucumis melo subsp. ... 96 4e-18 ref|XP_002332796.1| predicted protein [Populus trichocarpa] 94 1e-17 emb|CAN75115.1| hypothetical protein VITISV_002418 [Vitis vinifera] 94 1e-17 gb|ABM55241.1| retrotransposon protein [Beta vulgaris] 94 2e-17 gb|EMJ14028.1| hypothetical protein PRUPE_ppa020726mg [Prunus pe... 93 4e-17 emb|CAN68664.1| hypothetical protein VITISV_004416 [Vitis vinifera] 91 1e-16 >ref|XP_006359105.1| PREDICTED: uncharacterized protein LOC102581575, partial [Solanum tuberosum] Length = 910 Score = 103 bits (256), Expect = 3e-20 Identities = 50/68 (73%), Positives = 58/68 (85%) Frame = -1 Query: 355 DYINRWRNLSLNCKD*LSEASAIEMCIQGMNWGLCYILQGIKPKTFEELATRAYAIEISM 176 D+INRWR+ SLNCKD LSEAS IEM IQGM+WGL YILQGIKPKTFEELATRA+ +E+SM Sbjct: 331 DFINRWRHASLNCKDRLSEASGIEMYIQGMHWGLRYILQGIKPKTFEELATRAHDMELSM 390 Query: 175 NTDDQEYP 152 ++ E P Sbjct: 391 SSVGTEAP 398 >gb|EMJ12132.1| hypothetical protein PRUPE_ppa025679mg [Prunus persica] Length = 524 Score = 102 bits (255), Expect = 4e-20 Identities = 46/65 (70%), Positives = 57/65 (87%) Frame = -1 Query: 358 IDYINRWRNLSLNCKD*LSEASAIEMCIQGMNWGLCYILQGIKPKTFEELATRAYAIEIS 179 +DYINRWR+LSL+CKD +S+ SA+EMCIQGM+WGL YILQGIKP+TFEEL TRA+ IE+S Sbjct: 236 VDYINRWRSLSLDCKDRVSKLSAVEMCIQGMHWGLLYILQGIKPRTFEELTTRAHDIELS 295 Query: 178 MNTDD 164 + D Sbjct: 296 IANHD 300 >ref|XP_002323146.1| predicted protein [Populus trichocarpa] Length = 789 Score = 102 bits (255), Expect = 4e-20 Identities = 46/61 (75%), Positives = 57/61 (93%) Frame = -1 Query: 358 IDYINRWRNLSLNCKD*LSEASAIEMCIQGMNWGLCYILQGIKPKTFEELATRAYAIEIS 179 IDYI+RWRNLSLNC+D L+E SA++MCIQGM+WGL YILQGIKPK+FEELATRA+ +E+S Sbjct: 259 IDYIHRWRNLSLNCRDRLTETSALDMCIQGMHWGLRYILQGIKPKSFEELATRAHKMELS 318 Query: 178 M 176 + Sbjct: 319 I 319 >ref|XP_006370558.1| hypothetical protein POPTR_0001s437701g, partial [Populus trichocarpa] gi|550349763|gb|ERP67127.1| hypothetical protein POPTR_0001s437701g, partial [Populus trichocarpa] Length = 578 Score = 102 bits (254), Expect = 5e-20 Identities = 46/61 (75%), Positives = 57/61 (93%) Frame = -1 Query: 358 IDYINRWRNLSLNCKD*LSEASAIEMCIQGMNWGLCYILQGIKPKTFEELATRAYAIEIS 179 IDYI+RWRNLSLNC+D L+E SA++MCIQGM+WGL YILQGIKPK+FEELATRA+ +E+S Sbjct: 22 IDYIHRWRNLSLNCRDRLTETSALDMCIQGMHWGLRYILQGIKPKSFEELATRAHDMELS 81 Query: 178 M 176 + Sbjct: 82 I 82 >ref|XP_002334646.1| predicted protein [Populus trichocarpa] Length = 572 Score = 102 bits (254), Expect = 5e-20 Identities = 46/61 (75%), Positives = 57/61 (93%) Frame = -1 Query: 358 IDYINRWRNLSLNCKD*LSEASAIEMCIQGMNWGLCYILQGIKPKTFEELATRAYAIEIS 179 IDYI+RWRNLSLNC+D L+E SA++MCIQGM+WGL YILQGIKPK+FEELATRA+ +E+S Sbjct: 16 IDYIHRWRNLSLNCRDRLTETSALDMCIQGMHWGLRYILQGIKPKSFEELATRAHDMELS 75 Query: 178 M 176 + Sbjct: 76 I 76 >ref|XP_006371784.1| hypothetical protein POPTR_0018s03280g, partial [Populus trichocarpa] gi|550317934|gb|ERP49581.1| hypothetical protein POPTR_0018s03280g, partial [Populus trichocarpa] Length = 440 Score = 102 bits (253), Expect = 7e-20 Identities = 46/63 (73%), Positives = 58/63 (92%) Frame = -1 Query: 358 IDYINRWRNLSLNCKD*LSEASAIEMCIQGMNWGLCYILQGIKPKTFEELATRAYAIEIS 179 IDYI+RWRNLSLNC+D L+E SA++MCIQGM+WGL YILQGIKPK+FEELAT+A+ +E+S Sbjct: 16 IDYIHRWRNLSLNCRDRLTETSALDMCIQGMHWGLHYILQGIKPKSFEELATQAHDMELS 75 Query: 178 MNT 170 + T Sbjct: 76 IAT 78 >gb|ADN33758.1| retrotransposon protein putative ty3-gypsy sub-class [Cucumis melo subsp. melo] Length = 264 Score = 102 bits (253), Expect = 7e-20 Identities = 47/61 (77%), Positives = 55/61 (90%) Frame = -1 Query: 358 IDYINRWRNLSLNCKD*LSEASAIEMCIQGMNWGLCYILQGIKPKTFEELATRAYAIEIS 179 IDYINRWR LSL+CKD LSE SA+EMC QGM+WGL YILQGIKP+TFEELATRA+ +E+S Sbjct: 107 IDYINRWRALSLDCKDRLSELSAVEMCTQGMHWGLLYILQGIKPRTFEELATRAHDMELS 166 Query: 178 M 176 + Sbjct: 167 I 167 >gb|EMJ00639.1| hypothetical protein PRUPE_ppa026673mg [Prunus persica] Length = 468 Score = 101 bits (252), Expect = 9e-20 Identities = 45/65 (69%), Positives = 57/65 (87%) Frame = -1 Query: 358 IDYINRWRNLSLNCKD*LSEASAIEMCIQGMNWGLCYILQGIKPKTFEELATRAYAIEIS 179 +DYINRWR+LSL+CKD +SE SA+EMCIQGM+WGL YILQGIKP++FEEL TR + IE+S Sbjct: 225 VDYINRWRSLSLDCKDRVSELSAVEMCIQGMHWGLLYILQGIKPRSFEELTTRVHDIELS 284 Query: 178 MNTDD 164 + + D Sbjct: 285 IASHD 289 >gb|EMJ09426.1| hypothetical protein PRUPE_ppa018422mg, partial [Prunus persica] Length = 536 Score = 99.4 bits (246), Expect = 4e-19 Identities = 44/61 (72%), Positives = 54/61 (88%) Frame = -1 Query: 358 IDYINRWRNLSLNCKD*LSEASAIEMCIQGMNWGLCYILQGIKPKTFEELATRAYAIEIS 179 +DYINRWR+LSL+CKD +SE SA+EMCIQGM+W L YILQGIKP+TFEEL TR + IE+S Sbjct: 340 VDYINRWRSLSLDCKDRVSELSAVEMCIQGMHWSLLYILQGIKPRTFEELTTRVHDIELS 399 Query: 178 M 176 + Sbjct: 400 I 400 >ref|XP_002314375.1| predicted protein [Populus trichocarpa] Length = 1335 Score = 98.6 bits (244), Expect = 8e-19 Identities = 44/60 (73%), Positives = 56/60 (93%) Frame = -1 Query: 358 IDYINRWRNLSLNCKD*LSEASAIEMCIQGMNWGLCYILQGIKPKTFEELATRAYAIEIS 179 I+YI+RWRNLSLNC+D L++ SA++MCIQGM+WGL YILQGIKPK+FEELATRA+ +E+S Sbjct: 340 INYIHRWRNLSLNCRDRLTKTSALDMCIQGMHWGLRYILQGIKPKSFEELATRAHDMELS 399 >emb|CAN70888.1| hypothetical protein VITISV_005593 [Vitis vinifera] Length = 683 Score = 98.2 bits (243), Expect = 1e-18 Identities = 46/83 (55%), Positives = 64/83 (77%) Frame = -1 Query: 358 IDYINRWRNLSLNCKD*LSEASAIEMCIQGMNWGLCYILQGIKPKTFEELATRAYAIEIS 179 +DYIN WR+LSL+CKD LSE S +EMCIQGM+W L YILQGI+P+TFEELATRA+ +E++ Sbjct: 244 VDYINXWRSLSLDCKDRLSEVSTVEMCIQGMHWDLLYILQGIRPRTFEELATRAHDMELN 303 Query: 178 MNTDDQEYPSNINDDEGEEAEHG 110 + D + +++ D+ E +G Sbjct: 304 IANHDAK--NDLIIDQQRERHNG 324 >gb|ADN34247.1| ty3-gypsy retrotransposon protein [Cucumis melo subsp. melo] Length = 517 Score = 97.8 bits (242), Expect = 1e-18 Identities = 45/61 (73%), Positives = 54/61 (88%) Frame = -1 Query: 358 IDYINRWRNLSLNCKD*LSEASAIEMCIQGMNWGLCYILQGIKPKTFEELATRAYAIEIS 179 IDYINRWR LSL+CKD L+E SA+EMC QGM+W L YILQGIKP+TFEELATRA+ +E+S Sbjct: 305 IDYINRWRALSLDCKDKLTELSAVEMCTQGMHWELLYILQGIKPRTFEELATRAHDMELS 364 Query: 178 M 176 + Sbjct: 365 I 365 >gb|EMJ02808.1| hypothetical protein PRUPE_ppa019755mg [Prunus persica] Length = 226 Score = 96.7 bits (239), Expect = 3e-18 Identities = 44/65 (67%), Positives = 53/65 (81%) Frame = -1 Query: 358 IDYINRWRNLSLNCKD*LSEASAIEMCIQGMNWGLCYILQGIKPKTFEELATRAYAIEIS 179 +DYIN W +LSLNCKD +SE S +EMCIQGM+WGL YILQGIKP +FEEL TRA+ IE+S Sbjct: 153 VDYINCWSSLSLNCKDRVSELSVVEMCIQGMHWGLLYILQGIKPHSFEELTTRAHDIELS 212 Query: 178 MNTDD 164 + D Sbjct: 213 NTSHD 217 >ref|XP_002333404.1| predicted protein [Populus trichocarpa] Length = 447 Score = 96.7 bits (239), Expect = 3e-18 Identities = 44/61 (72%), Positives = 56/61 (91%) Frame = -1 Query: 358 IDYINRWRNLSLNCKD*LSEASAIEMCIQGMNWGLCYILQGIKPKTFEELATRAYAIEIS 179 IDYI+RWRNLSLN +D L+E SA++MCIQGM+WGL YILQGIKPK+FEELATRA+ +++S Sbjct: 220 IDYIHRWRNLSLNYRDRLTETSALDMCIQGMHWGLRYILQGIKPKSFEELATRAHDMKLS 279 Query: 178 M 176 + Sbjct: 280 I 280 >gb|ADN33709.1| retrotransposon gag protein [Cucumis melo subsp. melo] Length = 576 Score = 96.3 bits (238), Expect = 4e-18 Identities = 45/61 (73%), Positives = 53/61 (86%) Frame = -1 Query: 358 IDYINRWRNLSLNCKD*LSEASAIEMCIQGMNWGLCYILQGIKPKTFEELATRAYAIEIS 179 IDYINRWR LSL+CKD L+E SA+EMC QGM+W L YILQGIKP+TFEELATRA+ +E S Sbjct: 242 IDYINRWRALSLDCKDKLTELSAVEMCTQGMHWELLYILQGIKPRTFEELATRAHDMESS 301 Query: 178 M 176 + Sbjct: 302 I 302 >ref|XP_002332796.1| predicted protein [Populus trichocarpa] Length = 799 Score = 94.4 bits (233), Expect = 1e-17 Identities = 43/61 (70%), Positives = 55/61 (90%) Frame = -1 Query: 358 IDYINRWRNLSLNCKD*LSEASAIEMCIQGMNWGLCYILQGIKPKTFEELATRAYAIEIS 179 IDYI+RWRNLSLNC+D L++ A++M IQGM+WGL YILQGIKPK+FEELATRA+ +E+S Sbjct: 357 IDYIHRWRNLSLNCRDRLTKTYALDMYIQGMHWGLRYILQGIKPKSFEELATRAHDMELS 416 Query: 178 M 176 + Sbjct: 417 I 417 >emb|CAN75115.1| hypothetical protein VITISV_002418 [Vitis vinifera] Length = 127 Score = 94.4 bits (233), Expect = 1e-17 Identities = 42/60 (70%), Positives = 52/60 (86%) Frame = -1 Query: 355 DYINRWRNLSLNCKD*LSEASAIEMCIQGMNWGLCYILQGIKPKTFEELATRAYAIEISM 176 DYINRW +LSL+CKD LS+ SA+EMCIQGM+WG YI QGI+P TFEELATRA+ +E+S+ Sbjct: 34 DYINRWLSLSLDCKDRLSKVSAVEMCIQGMHWGFLYIFQGIRPHTFEELATRAHDMELSI 93 >gb|ABM55241.1| retrotransposon protein [Beta vulgaris] Length = 302 Score = 94.0 bits (232), Expect = 2e-17 Identities = 41/68 (60%), Positives = 55/68 (80%) Frame = -1 Query: 358 IDYINRWRNLSLNCKD*LSEASAIEMCIQGMNWGLCYILQGIKPKTFEELATRAYAIEIS 179 I+YINRWR L L CKD LS+ASA+E+C QG++W L YILQGIKP TF+ELATRA+ +E++ Sbjct: 234 IEYINRWRTLCLQCKDHLSKASAVELCTQGIHWDLTYILQGIKPNTFQELATRAHEMEMT 293 Query: 178 MNTDDQEY 155 + ++ Y Sbjct: 294 IANHEENY 301 >gb|EMJ14028.1| hypothetical protein PRUPE_ppa020726mg [Prunus persica] Length = 1078 Score = 92.8 bits (229), Expect = 4e-17 Identities = 42/61 (68%), Positives = 52/61 (85%) Frame = -1 Query: 358 IDYINRWRNLSLNCKD*LSEASAIEMCIQGMNWGLCYILQGIKPKTFEELATRAYAIEIS 179 +DYINRW +LSL+CK L E SA+EMCIQGM+WGL YILQGIKP+TFEELAT + +E+S Sbjct: 345 VDYINRWLSLSLDCKYRLLELSAVEMCIQGMHWGLLYILQGIKPRTFEELATHVHDMELS 404 Query: 178 M 176 + Sbjct: 405 I 405 >emb|CAN68664.1| hypothetical protein VITISV_004416 [Vitis vinifera] Length = 331 Score = 91.3 bits (225), Expect = 1e-16 Identities = 41/61 (67%), Positives = 52/61 (85%) Frame = -1 Query: 358 IDYINRWRNLSLNCKD*LSEASAIEMCIQGMNWGLCYILQGIKPKTFEELATRAYAIEIS 179 +DYIN W LSL+CK+ + E S++EMCIQGM+WGL YILQGI P+TFEELATRA+ +EIS Sbjct: 178 VDYINHWHFLSLDCKNRVYEVSSVEMCIQGMHWGLLYILQGILPRTFEELATRAHDMEIS 237 Query: 178 M 176 + Sbjct: 238 I 238