BLASTX nr result
ID: Rehmannia23_contig00032340
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00032340 (465 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526975.1| conserved hypothetical protein [Ricinus comm... 59 7e-07 >ref|XP_002526975.1| conserved hypothetical protein [Ricinus communis] gi|223533666|gb|EEF35402.1| conserved hypothetical protein [Ricinus communis] Length = 576 Score = 58.9 bits (141), Expect = 7e-07 Identities = 34/90 (37%), Positives = 53/90 (58%), Gaps = 1/90 (1%) Frame = +3 Query: 198 ASKSVASNQRETYVRTRDDSFFDGMRRGEAAVVKRDSAFDFQEKLEMKNIHRSASDIGDR 377 +S + S Q+E Y+RTR++ +F G+RRG+ A + DFQ +NI R+ S+I Sbjct: 3 SSAGIRSLQQEPYIRTRENPYFTGLRRGDIASRNQTPTLDFQGNDASRNISRTTSEISHA 62 Query: 378 RSQNNTFTVTEDVTYS-PKNSPSDIVLGPI 464 RS++ ++E S ++S SDIVL PI Sbjct: 63 RSKDFIQDISEKSNDSLLEDSVSDIVLNPI 92