BLASTX nr result
ID: Rehmannia23_contig00032260
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00032260 (421 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_005850417.1| hypothetical protein CHLNCDRAFT_142331 [Chlo... 57 3e-06 ref|NP_567089.1| methionine aminopeptidase 2B [Arabidopsis thali... 55 7e-06 ref|XP_006402632.1| hypothetical protein EUTSA_v10005983mg [Eutr... 55 7e-06 ref|XP_006372541.1| hypothetical protein POPTR_0017s02620g [Popu... 55 7e-06 ref|XP_004974072.1| PREDICTED: methionine aminopeptidase 2B-like... 55 7e-06 gb|EOX93239.1| Methionine aminopeptidase 2B [Theobroma cacao] 55 7e-06 ref|XP_006291441.1| hypothetical protein CARUB_v10017576mg [Caps... 55 7e-06 ref|XP_004309912.1| PREDICTED: methionine aminopeptidase 2B-like... 55 7e-06 ref|XP_004309911.1| PREDICTED: methionine aminopeptidase 2B-like... 55 7e-06 ref|XP_002878308.1| hypothetical protein ARALYDRAFT_486467 [Arab... 55 7e-06 ref|XP_002305888.1| METHIONINE AMINOPEPTIDASE 2A family protein ... 55 7e-06 ref|XP_002301676.1| predicted protein [Populus trichocarpa] 55 7e-06 emb|CAB75818.1| putative protein [Arabidopsis thaliana] 55 7e-06 gb|AAL38337.1| putative protein [Arabidopsis thaliana] gi|231977... 55 7e-06 ref|XP_004972955.1| PREDICTED: methionine aminopeptidase 2B-like... 55 1e-05 ref|XP_004972954.1| PREDICTED: methionine aminopeptidase 2B-like... 55 1e-05 gb|EMT05136.1| Methionine aminopeptidase 2B [Aegilops tauschii] 55 1e-05 gb|EMS53452.1| Methionine aminopeptidase 2B [Triticum urartu] 55 1e-05 gb|AFW61298.1| hypothetical protein ZEAMMB73_706709 [Zea mays] 55 1e-05 ref|XP_003574860.1| PREDICTED: methionine aminopeptidase 2B-like... 55 1e-05 >ref|XP_005850417.1| hypothetical protein CHLNCDRAFT_142331 [Chlorella variabilis] gi|307110078|gb|EFN58315.1| hypothetical protein CHLNCDRAFT_142331 [Chlorella variabilis] Length = 336 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -3 Query: 116 LLVNYLIDLDGLAVFTVKSIRNLNGHSIGPYQIHAGKS 3 ++ +Y ++LDG VF VKSIRNLNGHSIGPY+IHAGKS Sbjct: 165 VMESYEVELDG-KVFQVKSIRNLNGHSIGPYRIHAGKS 201 >ref|NP_567089.1| methionine aminopeptidase 2B [Arabidopsis thaliana] gi|30695106|ref|NP_850725.1| methionine aminopeptidase 2B [Arabidopsis thaliana] gi|79315754|ref|NP_001030898.1| methionine aminopeptidase 2B [Arabidopsis thaliana] gi|334186141|ref|NP_001190139.1| methionine aminopeptidase 2B [Arabidopsis thaliana] gi|85700451|sp|Q56Y85.2|MAP22_ARATH RecName: Full=Methionine aminopeptidase 2B; Short=MAP 2B; Short=MetAP 2B; AltName: Full=Peptidase M gi|11344922|gb|AAG34551.1|AF300880_1 putative methionine aminopeptidase 2 [Arabidopsis thaliana] gi|21536943|gb|AAM61284.1| putative methionine aminopeptidase [Arabidopsis thaliana] gi|332646475|gb|AEE79996.1| methionine aminopeptidase 2B [Arabidopsis thaliana] gi|332646476|gb|AEE79997.1| methionine aminopeptidase 2B [Arabidopsis thaliana] gi|332646477|gb|AEE79998.1| methionine aminopeptidase 2B [Arabidopsis thaliana] gi|332646478|gb|AEE79999.1| methionine aminopeptidase 2B [Arabidopsis thaliana] Length = 439 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -3 Query: 116 LLVNYLIDLDGLAVFTVKSIRNLNGHSIGPYQIHAGKS 3 ++ +Y ++++G VF VKSIRNLNGHSIGPYQIHAGKS Sbjct: 268 VMESYEVEING-KVFQVKSIRNLNGHSIGPYQIHAGKS 304 >ref|XP_006402632.1| hypothetical protein EUTSA_v10005983mg [Eutrema salsugineum] gi|567183256|ref|XP_006402633.1| hypothetical protein EUTSA_v10005983mg [Eutrema salsugineum] gi|557103731|gb|ESQ44085.1| hypothetical protein EUTSA_v10005983mg [Eutrema salsugineum] gi|557103732|gb|ESQ44086.1| hypothetical protein EUTSA_v10005983mg [Eutrema salsugineum] Length = 438 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -3 Query: 116 LLVNYLIDLDGLAVFTVKSIRNLNGHSIGPYQIHAGKS 3 ++ +Y ++++G VF VKSIRNLNGHSIGPYQIHAGKS Sbjct: 267 VMESYEVEING-KVFPVKSIRNLNGHSIGPYQIHAGKS 303 >ref|XP_006372541.1| hypothetical protein POPTR_0017s02620g [Populus trichocarpa] gi|550319170|gb|ERP50338.1| hypothetical protein POPTR_0017s02620g [Populus trichocarpa] Length = 421 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -3 Query: 116 LLVNYLIDLDGLAVFTVKSIRNLNGHSIGPYQIHAGKS 3 ++ +Y ++++G VF VKSIRNLNGHSIGPYQIHAGKS Sbjct: 250 VMESYEVEING-KVFQVKSIRNLNGHSIGPYQIHAGKS 286 >ref|XP_004974072.1| PREDICTED: methionine aminopeptidase 2B-like isoform X1 [Setaria italica] gi|514798258|ref|XP_004974073.1| PREDICTED: methionine aminopeptidase 2B-like isoform X2 [Setaria italica] Length = 446 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -3 Query: 116 LLVNYLIDLDGLAVFTVKSIRNLNGHSIGPYQIHAGKS 3 ++ +Y ++++G VF VKSIRNLNGHSIGPYQIHAGKS Sbjct: 275 VMESYEVEING-KVFQVKSIRNLNGHSIGPYQIHAGKS 311 >gb|EOX93239.1| Methionine aminopeptidase 2B [Theobroma cacao] Length = 514 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -3 Query: 116 LLVNYLIDLDGLAVFTVKSIRNLNGHSIGPYQIHAGKS 3 ++ +Y ++++G VF VKSIRNLNGHSIGPYQIHAGKS Sbjct: 343 VMESYEVEING-KVFQVKSIRNLNGHSIGPYQIHAGKS 379 >ref|XP_006291441.1| hypothetical protein CARUB_v10017576mg [Capsella rubella] gi|482560148|gb|EOA24339.1| hypothetical protein CARUB_v10017576mg [Capsella rubella] Length = 341 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -3 Query: 116 LLVNYLIDLDGLAVFTVKSIRNLNGHSIGPYQIHAGKS 3 ++ +Y ++++G VF VKSIRNLNGHSIGPYQIHAGKS Sbjct: 267 VMESYEVEING-KVFQVKSIRNLNGHSIGPYQIHAGKS 303 >ref|XP_004309912.1| PREDICTED: methionine aminopeptidase 2B-like [Fragaria vesca subsp. vesca] Length = 451 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -3 Query: 116 LLVNYLIDLDGLAVFTVKSIRNLNGHSIGPYQIHAGKS 3 ++ +Y ++++G VF VKSIRNLNGHSIGPYQIHAGKS Sbjct: 280 VMESYEVEING-KVFQVKSIRNLNGHSIGPYQIHAGKS 316 >ref|XP_004309911.1| PREDICTED: methionine aminopeptidase 2B-like [Fragaria vesca subsp. vesca] Length = 451 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -3 Query: 116 LLVNYLIDLDGLAVFTVKSIRNLNGHSIGPYQIHAGKS 3 ++ +Y ++++G VF VKSIRNLNGHSIGPYQIHAGKS Sbjct: 280 VMESYEVEING-KVFQVKSIRNLNGHSIGPYQIHAGKS 316 >ref|XP_002878308.1| hypothetical protein ARALYDRAFT_486467 [Arabidopsis lyrata subsp. lyrata] gi|297324146|gb|EFH54567.1| hypothetical protein ARALYDRAFT_486467 [Arabidopsis lyrata subsp. lyrata] Length = 440 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -3 Query: 116 LLVNYLIDLDGLAVFTVKSIRNLNGHSIGPYQIHAGKS 3 ++ +Y ++++G VF VKSIRNLNGHSIGPYQIHAGKS Sbjct: 269 VMESYEVEING-KVFQVKSIRNLNGHSIGPYQIHAGKS 305 >ref|XP_002305888.1| METHIONINE AMINOPEPTIDASE 2A family protein [Populus trichocarpa] gi|222848852|gb|EEE86399.1| METHIONINE AMINOPEPTIDASE 2A family protein [Populus trichocarpa] Length = 394 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -3 Query: 116 LLVNYLIDLDGLAVFTVKSIRNLNGHSIGPYQIHAGKS 3 ++ +Y ++++G VF VKSIRNLNGHSIGPYQIHAGKS Sbjct: 223 VMESYEVEING-KVFQVKSIRNLNGHSIGPYQIHAGKS 259 >ref|XP_002301676.1| predicted protein [Populus trichocarpa] Length = 380 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -3 Query: 116 LLVNYLIDLDGLAVFTVKSIRNLNGHSIGPYQIHAGKS 3 ++ +Y ++++G VF VKSIRNLNGHSIGPYQIHAGKS Sbjct: 209 VMESYEVEING-KVFQVKSIRNLNGHSIGPYQIHAGKS 245 >emb|CAB75818.1| putative protein [Arabidopsis thaliana] Length = 435 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -3 Query: 116 LLVNYLIDLDGLAVFTVKSIRNLNGHSIGPYQIHAGKS 3 ++ +Y ++++G VF VKSIRNLNGHSIGPYQIHAGKS Sbjct: 264 VMESYEVEING-KVFQVKSIRNLNGHSIGPYQIHAGKS 300 >gb|AAL38337.1| putative protein [Arabidopsis thaliana] gi|23197710|gb|AAN15382.1| putative protein [Arabidopsis thaliana] Length = 439 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -3 Query: 116 LLVNYLIDLDGLAVFTVKSIRNLNGHSIGPYQIHAGKS 3 ++ +Y ++++G VF VKSIRNLNGHSIGPYQIHAGKS Sbjct: 268 VMKSYEVEING-KVFQVKSIRNLNGHSIGPYQIHAGKS 304 >ref|XP_004972955.1| PREDICTED: methionine aminopeptidase 2B-like isoform X2 [Setaria italica] Length = 446 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = -3 Query: 116 LLVNYLIDLDGLAVFTVKSIRNLNGHSIGPYQIHAGKS 3 ++ +Y ++++G VF VKS+RNLNGHSIGPYQIHAGKS Sbjct: 275 VMESYEVEING-KVFQVKSVRNLNGHSIGPYQIHAGKS 311 >ref|XP_004972954.1| PREDICTED: methionine aminopeptidase 2B-like isoform X1 [Setaria italica] Length = 447 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = -3 Query: 116 LLVNYLIDLDGLAVFTVKSIRNLNGHSIGPYQIHAGKS 3 ++ +Y ++++G VF VKS+RNLNGHSIGPYQIHAGKS Sbjct: 276 VMESYEVEING-KVFQVKSVRNLNGHSIGPYQIHAGKS 312 >gb|EMT05136.1| Methionine aminopeptidase 2B [Aegilops tauschii] Length = 475 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = -3 Query: 116 LLVNYLIDLDGLAVFTVKSIRNLNGHSIGPYQIHAGKS 3 ++ +Y ++++G VF VKS+RNLNGHSIGPYQIHAGKS Sbjct: 277 VMESYEVEING-KVFQVKSVRNLNGHSIGPYQIHAGKS 313 >gb|EMS53452.1| Methionine aminopeptidase 2B [Triticum urartu] Length = 421 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = -3 Query: 116 LLVNYLIDLDGLAVFTVKSIRNLNGHSIGPYQIHAGKS 3 ++ +Y ++++G VF VKS+RNLNGHSIGPYQIHAGKS Sbjct: 250 VMESYEVEING-KVFQVKSVRNLNGHSIGPYQIHAGKS 286 >gb|AFW61298.1| hypothetical protein ZEAMMB73_706709 [Zea mays] Length = 448 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = -3 Query: 116 LLVNYLIDLDGLAVFTVKSIRNLNGHSIGPYQIHAGKS 3 ++ +Y ++++G VF VKS+RNLNGHSIGPYQIHAGKS Sbjct: 277 VMESYEVEING-KVFQVKSVRNLNGHSIGPYQIHAGKS 313 >ref|XP_003574860.1| PREDICTED: methionine aminopeptidase 2B-like [Brachypodium distachyon] Length = 449 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = -3 Query: 116 LLVNYLIDLDGLAVFTVKSIRNLNGHSIGPYQIHAGKS 3 ++ +Y ++++G VF VKS+RNLNGHSIGPYQIHAGKS Sbjct: 278 VMESYEVEING-KVFQVKSVRNLNGHSIGPYQIHAGKS 314