BLASTX nr result
ID: Rehmannia23_contig00032250
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00032250 (420 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006381443.1| hypothetical protein POPTR_0006s12890g [Popu... 61 2e-07 gb|EXC16204.1| hypothetical protein L484_024375 [Morus notabilis] 57 3e-06 >ref|XP_006381443.1| hypothetical protein POPTR_0006s12890g [Populus trichocarpa] gi|550336146|gb|ERP59240.1| hypothetical protein POPTR_0006s12890g [Populus trichocarpa] Length = 77 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +3 Query: 195 MGYIVVVSLPVILFFLITAIACYPFGRARGRRENVRLPQYY 317 MGY+V+VSLPVILF LI A+A Y GRARGR E R+PQY+ Sbjct: 1 MGYVVIVSLPVILFILIVALAFYLLGRARGRSEAARIPQYH 41 >gb|EXC16204.1| hypothetical protein L484_024375 [Morus notabilis] Length = 61 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +3 Query: 195 MGYIVVVSLPVILFFLITAIACYPFGRARGRRENVRLPQYY 317 MGYIVV+S+PVILF LI A+A Y GRARGR + +PQYY Sbjct: 1 MGYIVVLSVPVILFILIVALAFYLLGRARGRSQAESVPQYY 41