BLASTX nr result
ID: Rehmannia23_contig00032037
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00032037 (443 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC78894.1| hypothetical protein (mitochondrion) [Vicia faba]... 103 3e-20 gb|EXB29791.1| hypothetical protein L484_008955 [Morus notabilis] 81 4e-16 ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] g... 70 2e-10 ref|XP_002535311.1| conserved hypothetical protein [Ricinus comm... 54 4e-09 ref|XP_002531802.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 >gb|AGC78894.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803272|gb|AGC79007.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 602 Score = 103 bits (256), Expect = 3e-20 Identities = 51/58 (87%), Positives = 51/58 (87%) Frame = +2 Query: 269 MGQRIKRFDFVSRDPPQVGFESRVMGHYPARFGEHF*SALVNRSPPIKQEGSGSSHGG 442 MGQRIKRFDFVSRD PQVGFESRVMG YPARFGEHF SALVN SP IKQE SG SHGG Sbjct: 1 MGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGEHFLSALVNGSPSIKQERSGYSHGG 58 >gb|EXB29791.1| hypothetical protein L484_008955 [Morus notabilis] Length = 69 Score = 80.9 bits (198), Expect(2) = 4e-16 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -2 Query: 403 GASIHQRRLKVLSEPCWIVTHHTALKPNLWWIPGDKV 293 GASIHQRRLKVLSEPCWIVTHHTALKPNLWWIP D + Sbjct: 17 GASIHQRRLKVLSEPCWIVTHHTALKPNLWWIPADVI 53 Score = 29.3 bits (64), Expect(2) = 4e-16 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 441 PPWEEPLPSCLMGG 400 PPWEEPL SCL+ G Sbjct: 4 PPWEEPLLSCLIVG 17 >ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] gi|355477354|gb|AES58557.1| Ribosomal protein S3 [Medicago truncatula] Length = 306 Score = 70.5 bits (171), Expect = 2e-10 Identities = 38/58 (65%), Positives = 38/58 (65%) Frame = +2 Query: 269 MGQRIKRFDFVSRDPPQVGFESRVMGHYPARFGEHF*SALVNRSPPIKQEGSGSSHGG 442 MGQRIKRFDFVSRD PQVGFESRVMG YPARFGE SG SHGG Sbjct: 1 MGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGE-----------------SGYSHGG 41 >ref|XP_002535311.1| conserved hypothetical protein [Ricinus communis] gi|223523476|gb|EEF27072.1| conserved hypothetical protein [Ricinus communis] Length = 63 Score = 54.3 bits (129), Expect(2) = 4e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -2 Query: 229 SRDRLSFKPLSFGSDKSSPFGRFAQV 152 +RDRLSFKPLSFGSDKSSPFGRFAQV Sbjct: 9 ARDRLSFKPLSFGSDKSSPFGRFAQV 34 Score = 32.3 bits (72), Expect(2) = 4e-09 Identities = 17/30 (56%), Positives = 22/30 (73%), Gaps = 3/30 (10%) Frame = -3 Query: 159 LRWSS--LIFPNVQRFE-MRKEHRPSAMNE 79 +RWSS + FPNV+ +RKEHRPS +NE Sbjct: 34 VRWSSRSVGFPNVKSCSGLRKEHRPSTLNE 63 >ref|XP_002531802.1| conserved hypothetical protein [Ricinus communis] gi|223528568|gb|EEF30590.1| conserved hypothetical protein [Ricinus communis] Length = 72 Score = 57.0 bits (136), Expect = 3e-06 Identities = 33/59 (55%), Positives = 37/59 (62%), Gaps = 1/59 (1%) Frame = -2 Query: 412 LDGGASIHQRRLKVLSEPCWIVTHHTALKPNLW-WIPGDKVKALDPLPHTLRCSSPSIK 239 L G SI Q RLKVL EPC I+T++T GD VKALDPLPHTL+ SS IK Sbjct: 14 LTRGPSIQQCRLKVLCEPCRIITYYTTHSSQTCDGSQGDNVKALDPLPHTLKGSSTPIK 72