BLASTX nr result
ID: Rehmannia23_contig00031242
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00031242 (419 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004891619.1| unnamed protein product (chloroplast) [Nicot... 93 4e-17 ref|NP_054513.1| hypothetical protein NitaCp037 [Nicotiana tabac... 89 6e-16 ref|YP_398878.1| hypothetical protein NitoCp045 [Nicotiana tomen... 88 1e-15 >ref|YP_004891619.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|347453920|gb|AEO95578.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347454031|gb|AEO95688.1| hypothetical protein [synthetic construct] Length = 99 Score = 92.8 bits (229), Expect = 4e-17 Identities = 42/53 (79%), Positives = 45/53 (84%) Frame = +3 Query: 261 RKRNPLYHLDEKKTLILKNPTGPFPSNQTNKEGNPIEFLRFHAYNSIHSITIG 419 RKRNP YHLDEK +ILKN TGP PSNQTNKEGNP+EFLRFH +SIHSIT G Sbjct: 13 RKRNPFYHLDEKNIMILKNSTGPSPSNQTNKEGNPVEFLRFHVDDSIHSITTG 65 >ref|NP_054513.1| hypothetical protein NitaCp037 [Nicotiana tabacum] gi|78102550|ref|YP_358691.1| hypothetical protein NisyCp046 [Nicotiana sylvestris] gi|11846|emb|CAA77366.1| hypothetical protein [Nicotiana tabacum] gi|77799577|dbj|BAE46666.1| hypothetical protein [Nicotiana sylvestris] gi|225214|prf||1211235AV ORF 99A Length = 99 Score = 89.0 bits (219), Expect = 6e-16 Identities = 41/53 (77%), Positives = 44/53 (83%) Frame = +3 Query: 261 RKRNPLYHLDEKKTLILKNPTGPFPSNQTNKEGNPIEFLRFHAYNSIHSITIG 419 RKRNP YHLDEK +ILKN TGP PSNQTNKEGN +EFLRFH +SIHSIT G Sbjct: 13 RKRNPFYHLDEKNIMILKNSTGPSPSNQTNKEGNSVEFLRFHVDDSIHSITRG 65 >ref|YP_398878.1| hypothetical protein NitoCp045 [Nicotiana tomentosiformis] gi|80750940|dbj|BAE48016.1| hypothetical protein [Nicotiana tomentosiformis] Length = 99 Score = 88.2 bits (217), Expect = 1e-15 Identities = 40/53 (75%), Positives = 43/53 (81%) Frame = +3 Query: 261 RKRNPLYHLDEKKTLILKNPTGPFPSNQTNKEGNPIEFLRFHAYNSIHSITIG 419 RKRNP YHLDEK +ILKN GP PSNQT KEGNP+EFLRFH +SIHSIT G Sbjct: 13 RKRNPFYHLDEKNIMILKNSPGPSPSNQTKKEGNPVEFLRFHVDDSIHSITTG 65