BLASTX nr result
ID: Rehmannia23_contig00031081
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00031081 (344 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528200.1| regulator of telomere elongation helicase 1 ... 60 4e-07 >ref|XP_002528200.1| regulator of telomere elongation helicase 1 rtel1, putative [Ricinus communis] gi|223532412|gb|EEF34207.1| regulator of telomere elongation helicase 1 rtel1, putative [Ricinus communis] Length = 1049 Score = 59.7 bits (143), Expect = 4e-07 Identities = 39/105 (37%), Positives = 59/105 (56%) Frame = +3 Query: 6 KLELTQNENQESVRVLHSSQPMDKFHLEKLLVPQMTAVDRXXXXXXXXXTKQVKQGDISS 185 KL+ + E+ E+VR + ++QP+DKF+L+ L T D+ +V+ G S Sbjct: 726 KLKTIKIEDMENVREMKTTQPIDKFYLDGFLSTP-TPQDQSPGVKLSSSLLKVRGGKESK 784 Query: 186 RLKEIVPANRSYLTSDKIFHDSSFKCSNDPTRTRKEPLISGKKSI 320 +L+E++PANRS LT+ K HD K S+ K LISG+K I Sbjct: 785 QLQEVLPANRSSLTTFKENHDFKPKFSSGLIHKEKILLISGRKDI 829