BLASTX nr result
ID: Rehmannia23_contig00030160
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00030160 (495 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006422030.1| hypothetical protein CICLE_v10004632mg [Citr... 70 2e-10 ref|XP_006422029.1| hypothetical protein CICLE_v10004632mg [Citr... 70 2e-10 ref|XP_006422028.1| hypothetical protein CICLE_v10004632mg [Citr... 70 2e-10 ref|XP_006422027.1| hypothetical protein CICLE_v10004632mg [Citr... 70 2e-10 ref|XP_003634123.1| PREDICTED: UDP-N-acetylmuramate--L-alanine l... 70 2e-10 emb|CBI22661.3| unnamed protein product [Vitis vinifera] 70 2e-10 gb|EMJ21962.1| hypothetical protein PRUPE_ppa026025mg [Prunus pe... 70 3e-10 ref|XP_006490640.1| PREDICTED: uncharacterized protein LOC102629... 69 7e-10 ref|XP_006490639.1| PREDICTED: uncharacterized protein LOC102629... 69 7e-10 ref|XP_006490638.1| PREDICTED: uncharacterized protein LOC102629... 69 7e-10 ref|XP_006490637.1| PREDICTED: uncharacterized protein LOC102629... 69 7e-10 ref|XP_006490636.1| PREDICTED: uncharacterized protein LOC102629... 69 7e-10 gb|EOY23305.1| Uncharacterized protein isoform 2 [Theobroma cacao] 67 2e-09 gb|EOY23304.1| Uncharacterized protein isoform 1 [Theobroma cacao] 67 2e-09 ref|XP_006353915.1| PREDICTED: uncharacterized protein LOC102591... 67 3e-09 ref|WP_020806763.1| UDP-N-acetylmuramate--L-alanine ligase [Lact... 66 4e-09 ref|NP_965470.1| UDP-N-acetylmuramate--L-alanine ligase [Lactoba... 66 4e-09 ref|WP_004897813.1| UDP-N-acetylmuramate--alanine ligase [Lactob... 66 4e-09 ref|YP_005862677.1| UDP-N-acetylmuramate-alanine ligase [Lactoba... 66 4e-09 ref|YP_003293577.1| hypothetical protein FI9785_1451 [Lactobacil... 66 4e-09 >ref|XP_006422030.1| hypothetical protein CICLE_v10004632mg [Citrus clementina] gi|557523903|gb|ESR35270.1| hypothetical protein CICLE_v10004632mg [Citrus clementina] Length = 378 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = -1 Query: 177 T*YCNNIFDDYAHHPTEVRAVLQAARKMFPSKELLVVFQPHTY 49 T Y +I+DD+AHHPTEVRAVLQAAR+ FP+K L+VVFQPHTY Sbjct: 231 TIYGCHIYDDFAHHPTEVRAVLQAARQRFPNKALIVVFQPHTY 273 >ref|XP_006422029.1| hypothetical protein CICLE_v10004632mg [Citrus clementina] gi|557523902|gb|ESR35269.1| hypothetical protein CICLE_v10004632mg [Citrus clementina] Length = 575 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = -1 Query: 177 T*YCNNIFDDYAHHPTEVRAVLQAARKMFPSKELLVVFQPHTY 49 T Y +I+DD+AHHPTEVRAVLQAAR+ FP+K L+VVFQPHTY Sbjct: 428 TIYGCHIYDDFAHHPTEVRAVLQAARQRFPNKALIVVFQPHTY 470 >ref|XP_006422028.1| hypothetical protein CICLE_v10004632mg [Citrus clementina] gi|557523901|gb|ESR35268.1| hypothetical protein CICLE_v10004632mg [Citrus clementina] Length = 527 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = -1 Query: 177 T*YCNNIFDDYAHHPTEVRAVLQAARKMFPSKELLVVFQPHTY 49 T Y +I+DD+AHHPTEVRAVLQAAR+ FP+K L+VVFQPHTY Sbjct: 428 TIYGCHIYDDFAHHPTEVRAVLQAARQRFPNKALIVVFQPHTY 470 >ref|XP_006422027.1| hypothetical protein CICLE_v10004632mg [Citrus clementina] gi|557523900|gb|ESR35267.1| hypothetical protein CICLE_v10004632mg [Citrus clementina] Length = 417 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = -1 Query: 177 T*YCNNIFDDYAHHPTEVRAVLQAARKMFPSKELLVVFQPHTY 49 T Y +I+DD+AHHPTEVRAVLQAAR+ FP+K L+VVFQPHTY Sbjct: 270 TIYGCHIYDDFAHHPTEVRAVLQAARQRFPNKALIVVFQPHTY 312 >ref|XP_003634123.1| PREDICTED: UDP-N-acetylmuramate--L-alanine ligase-like [Vitis vinifera] Length = 541 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -1 Query: 159 IFDDYAHHPTEVRAVLQAARKMFPSKELLVVFQPHTY 49 I+DDYAHHPTEVRAVLQAAR+ FP K LLVVFQPHTY Sbjct: 381 IYDDYAHHPTEVRAVLQAARQRFPLKALLVVFQPHTY 417 >emb|CBI22661.3| unnamed protein product [Vitis vinifera] Length = 626 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -1 Query: 159 IFDDYAHHPTEVRAVLQAARKMFPSKELLVVFQPHTY 49 I+DDYAHHPTEVRAVLQAAR+ FP K LLVVFQPHTY Sbjct: 408 IYDDYAHHPTEVRAVLQAARQRFPLKALLVVFQPHTY 444 >gb|EMJ21962.1| hypothetical protein PRUPE_ppa026025mg [Prunus persica] Length = 528 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = -1 Query: 177 T*YCNNIFDDYAHHPTEVRAVLQAARKMFPSKELLVVFQPHTY 49 T Y +I+DDYAHHPTEV AV+QAAR+ FP+K LLVVFQPHTY Sbjct: 428 TIYGCHIYDDYAHHPTEVSAVIQAARQRFPNKSLLVVFQPHTY 470 >ref|XP_006490640.1| PREDICTED: uncharacterized protein LOC102629810 isoform X5 [Citrus sinensis] Length = 417 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = -1 Query: 177 T*YCNNIFDDYAHHPTEVRAVLQAARKMFPSKELLVVFQPHTY 49 T Y +I+DD+AHHPTEVRAVLQAAR+ FP+K L+ VFQPHTY Sbjct: 270 TIYGCHIYDDFAHHPTEVRAVLQAARQRFPNKALIAVFQPHTY 312 >ref|XP_006490639.1| PREDICTED: uncharacterized protein LOC102629810 isoform X4 [Citrus sinensis] Length = 443 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = -1 Query: 177 T*YCNNIFDDYAHHPTEVRAVLQAARKMFPSKELLVVFQPHTY 49 T Y +I+DD+AHHPTEVRAVLQAAR+ FP+K L+ VFQPHTY Sbjct: 296 TIYGCHIYDDFAHHPTEVRAVLQAARQRFPNKALIAVFQPHTY 338 >ref|XP_006490638.1| PREDICTED: uncharacterized protein LOC102629810 isoform X3 [Citrus sinensis] Length = 502 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = -1 Query: 177 T*YCNNIFDDYAHHPTEVRAVLQAARKMFPSKELLVVFQPHTY 49 T Y +I+DD+AHHPTEVRAVLQAAR+ FP+K L+ VFQPHTY Sbjct: 355 TIYGCHIYDDFAHHPTEVRAVLQAARQRFPNKALIAVFQPHTY 397 >ref|XP_006490637.1| PREDICTED: uncharacterized protein LOC102629810 isoform X2 [Citrus sinensis] Length = 507 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = -1 Query: 177 T*YCNNIFDDYAHHPTEVRAVLQAARKMFPSKELLVVFQPHTY 49 T Y +I+DD+AHHPTEVRAVLQAAR+ FP+K L+ VFQPHTY Sbjct: 360 TIYGCHIYDDFAHHPTEVRAVLQAARQRFPNKALIAVFQPHTY 402 >ref|XP_006490636.1| PREDICTED: uncharacterized protein LOC102629810 isoform X1 [Citrus sinensis] Length = 575 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = -1 Query: 177 T*YCNNIFDDYAHHPTEVRAVLQAARKMFPSKELLVVFQPHTY 49 T Y +I+DD+AHHPTEVRAVLQAAR+ FP+K L+ VFQPHTY Sbjct: 428 TIYGCHIYDDFAHHPTEVRAVLQAARQRFPNKALIAVFQPHTY 470 >gb|EOY23305.1| Uncharacterized protein isoform 2 [Theobroma cacao] Length = 496 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -1 Query: 162 NIFDDYAHHPTEVRAVLQAARKMFPSKELLVVFQPHTY 49 +I+DDYAHHPTEV VLQAAR+ FP K LLVVFQPHTY Sbjct: 428 HIYDDYAHHPTEVYVVLQAARQRFPFKRLLVVFQPHTY 465 >gb|EOY23304.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 619 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -1 Query: 162 NIFDDYAHHPTEVRAVLQAARKMFPSKELLVVFQPHTY 49 +I+DDYAHHPTEV VLQAAR+ FP K LLVVFQPHTY Sbjct: 475 HIYDDYAHHPTEVYVVLQAARQRFPFKRLLVVFQPHTY 512 >ref|XP_006353915.1| PREDICTED: uncharacterized protein LOC102591145 [Solanum tuberosum] Length = 196 Score = 66.6 bits (161), Expect = 3e-09 Identities = 27/38 (71%), Positives = 36/38 (94%) Frame = -1 Query: 162 NIFDDYAHHPTEVRAVLQAARKMFPSKELLVVFQPHTY 49 +I+DDYAHHPTE++AVLQAAR+ FP ++L+V+FQPHTY Sbjct: 58 HIYDDYAHHPTEIQAVLQAARQRFPFQKLVVIFQPHTY 95 >ref|WP_020806763.1| UDP-N-acetylmuramate--L-alanine ligase [Lactobacillus gasseri] gi|509283913|gb|EOY36427.1| UDP-N-acetylmuramate--L-alanine ligase [Lactobacillus gasseri K7] Length = 437 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = -1 Query: 162 NIFDDYAHHPTEVRAVLQAARKMFPSKELLVVFQPHTY 49 ++ DDYAHHPTE+RA +QAAR+ FP KEL+VVFQPHT+ Sbjct: 314 SVIDDYAHHPTEMRATIQAARQKFPDKELVVVFQPHTF 351 >ref|NP_965470.1| UDP-N-acetylmuramate--L-alanine ligase [Lactobacillus johnsonii NCC 533] gi|560152625|ref|YP_008845483.1| UDP-N-acetylmuramate--alanine ligase [Lactobacillus johnsonii N6.2] gi|499475710|ref|WP_011162350.1| UDP-N-acetylmuramate--alanine ligase [Lactobacillus johnsonii] gi|48428300|sp|P61680.1|MURC_LACJO RecName: Full=UDP-N-acetylmuramate--L-alanine ligase; AltName: Full=UDP-N-acetylmuramoyl-L-alanine synthetase gi|41583829|gb|AAS09436.1| UDP-N-acetylmuramate-alanine ligase [Lactobacillus johnsonii NCC 533] gi|559162461|gb|AHA97774.1| UDP-N-acetylmuramate--alanine ligase [Lactobacillus johnsonii N6.2] Length = 437 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = -1 Query: 162 NIFDDYAHHPTEVRAVLQAARKMFPSKELLVVFQPHTY 49 ++ DDYAHHPTE+RA +QAAR+ FP KEL+VVFQPHT+ Sbjct: 314 SVIDDYAHHPTEMRATIQAARQKFPDKELVVVFQPHTF 351 >ref|WP_004897813.1| UDP-N-acetylmuramate--alanine ligase [Lactobacillus johnsonii] gi|338761568|gb|EGP12837.1| UDP-N-acetylmuramate--alanine ligase [Lactobacillus johnsonii pf01] Length = 437 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = -1 Query: 162 NIFDDYAHHPTEVRAVLQAARKMFPSKELLVVFQPHTY 49 ++ DDYAHHPTE+RA +QAAR+ FP KEL+VVFQPHT+ Sbjct: 314 SVIDDYAHHPTEMRATIQAARQKFPDKELVVVFQPHTF 351 >ref|YP_005862677.1| UDP-N-acetylmuramate-alanine ligase [Lactobacillus johnsonii DPC 6026] gi|504380616|ref|WP_014567718.1| UDP-N-acetylmuramate--alanine ligase [Lactobacillus johnsonii] gi|329667779|gb|AEB93727.1| UDP-N-acetylmuramate-alanine ligase [Lactobacillus johnsonii DPC 6026] Length = 437 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = -1 Query: 162 NIFDDYAHHPTEVRAVLQAARKMFPSKELLVVFQPHTY 49 ++ DDYAHHPTE+RA +QAAR+ FP KEL+VVFQPHT+ Sbjct: 314 SVIDDYAHHPTEMRATIQAARQKFPDKELVVVFQPHTF 351 >ref|YP_003293577.1| hypothetical protein FI9785_1451 [Lactobacillus johnsonii FI9785] gi|502609497|ref|WP_012846527.1| UDP-N-acetylmuramate--alanine ligase [Lactobacillus johnsonii] gi|262398296|emb|CAX67310.1| murC [Lactobacillus johnsonii FI9785] Length = 437 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = -1 Query: 162 NIFDDYAHHPTEVRAVLQAARKMFPSKELLVVFQPHTY 49 ++ DDYAHHPTE+RA +QAAR+ FP KEL+VVFQPHT+ Sbjct: 314 SVIDDYAHHPTEMRATIQAARQKFPDKELVVVFQPHTF 351