BLASTX nr result
ID: Rehmannia23_contig00030089
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00030089 (483 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOX92004.1| RING/U-box superfamily protein, putative [Theobro... 57 3e-06 >gb|EOX92004.1| RING/U-box superfamily protein, putative [Theobroma cacao] Length = 386 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/54 (55%), Positives = 37/54 (68%) Frame = +1 Query: 1 IIAKRGCKNSRIYRMIKSSSFGRSLEKGPVSMKRSFSFSGKRSLRKNSRSLESI 162 I+ KRG ++S I +M+KS S GRSL KG +SMKRSFS GK K RS +SI Sbjct: 330 IVGKRGSESSSICKMMKSCSIGRSLSKGQISMKRSFSSGGKFLSSKKCRSQDSI 383