BLASTX nr result
ID: Rehmannia23_contig00029397
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00029397 (433 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI39605.3| unnamed protein product [Vitis vinifera] 103 3e-20 ref|XP_002281942.1| PREDICTED: pentatricopeptide repeat-containi... 103 3e-20 emb|CAN61593.1| hypothetical protein VITISV_030555 [Vitis vinifera] 103 3e-20 gb|EMJ08247.1| hypothetical protein PRUPE_ppb025182mg [Prunus pe... 102 7e-20 ref|XP_006433546.1| hypothetical protein CICLE_v10003403mg [Citr... 101 9e-20 emb|CBI16436.3| unnamed protein product [Vitis vinifera] 100 3e-19 ref|XP_002283117.1| PREDICTED: pentatricopeptide repeat-containi... 100 3e-19 emb|CAN80267.1| hypothetical protein VITISV_027683 [Vitis vinifera] 100 3e-19 ref|XP_006382375.1| hypothetical protein POPTR_0005s01560g [Popu... 100 3e-19 ref|XP_002330082.1| predicted protein [Populus trichocarpa] 100 3e-19 ref|XP_004514991.1| PREDICTED: pentatricopeptide repeat-containi... 99 5e-19 ref|XP_002270940.2| PREDICTED: pentatricopeptide repeat-containi... 99 5e-19 ref|XP_003635359.1| PREDICTED: pentatricopeptide repeat-containi... 99 5e-19 emb|CBI41082.3| unnamed protein product [Vitis vinifera] 99 5e-19 ref|XP_006443657.1| hypothetical protein CICLE_v10019256mg [Citr... 99 8e-19 gb|EOY07940.1| Tetratricopeptide repeat-like superfamily protein... 99 8e-19 gb|EOY17244.1| Pentatricopeptide repeat (PPR) superfamily protei... 98 1e-18 ref|XP_004304899.1| PREDICTED: pentatricopeptide repeat-containi... 98 1e-18 ref|XP_004958944.1| PREDICTED: pentatricopeptide repeat-containi... 97 2e-18 ref|XP_004288820.1| PREDICTED: pentatricopeptide repeat-containi... 97 2e-18 >emb|CBI39605.3| unnamed protein product [Vitis vinifera] Length = 624 Score = 103 bits (256), Expect = 3e-20 Identities = 43/56 (76%), Positives = 50/56 (89%) Frame = -3 Query: 431 TEPGATIRVVKNLRVCGDCHSAIKIISRVYKRKIIVRDRVRYHHFKHGQCSCKDFW 264 T PG TIR+VKNLRVC DCHSA K+IS+VY R+IIVRDR+RYHHF++G CSCKDFW Sbjct: 569 TSPGTTIRIVKNLRVCEDCHSATKLISQVYNREIIVRDRIRYHHFRNGACSCKDFW 624 >ref|XP_002281942.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910 isoform 1 [Vitis vinifera] Length = 672 Score = 103 bits (256), Expect = 3e-20 Identities = 43/56 (76%), Positives = 50/56 (89%) Frame = -3 Query: 431 TEPGATIRVVKNLRVCGDCHSAIKIISRVYKRKIIVRDRVRYHHFKHGQCSCKDFW 264 T PG TIR+VKNLRVC DCHSA K+IS+VY R+IIVRDR+RYHHF++G CSCKDFW Sbjct: 617 TSPGTTIRIVKNLRVCEDCHSATKLISQVYNREIIVRDRIRYHHFRNGACSCKDFW 672 >emb|CAN61593.1| hypothetical protein VITISV_030555 [Vitis vinifera] Length = 673 Score = 103 bits (256), Expect = 3e-20 Identities = 43/56 (76%), Positives = 50/56 (89%) Frame = -3 Query: 431 TEPGATIRVVKNLRVCGDCHSAIKIISRVYKRKIIVRDRVRYHHFKHGQCSCKDFW 264 T PG TIR+VKNLRVC DCHSA K+IS+VY R+IIVRDR+RYHHF++G CSCKDFW Sbjct: 618 TSPGTTIRIVKNLRVCEDCHSATKLISQVYNREIIVRDRIRYHHFRNGACSCKDFW 673 >gb|EMJ08247.1| hypothetical protein PRUPE_ppb025182mg [Prunus persica] Length = 672 Score = 102 bits (253), Expect = 7e-20 Identities = 43/56 (76%), Positives = 50/56 (89%) Frame = -3 Query: 431 TEPGATIRVVKNLRVCGDCHSAIKIISRVYKRKIIVRDRVRYHHFKHGQCSCKDFW 264 T+PG TIRV KNLR C DCHSAIKI S+VY+R IIVRDR+RYHHF++G+CSCKDFW Sbjct: 617 TKPGTTIRVTKNLRTCEDCHSAIKIFSKVYERDIIVRDRMRYHHFRNGRCSCKDFW 672 >ref|XP_006433546.1| hypothetical protein CICLE_v10003403mg [Citrus clementina] gi|557535668|gb|ESR46786.1| hypothetical protein CICLE_v10003403mg [Citrus clementina] Length = 558 Score = 101 bits (252), Expect = 9e-20 Identities = 43/56 (76%), Positives = 50/56 (89%) Frame = -3 Query: 431 TEPGATIRVVKNLRVCGDCHSAIKIISRVYKRKIIVRDRVRYHHFKHGQCSCKDFW 264 T PGATIRV+KNLRVC DCHSA K+I +V+KR IIVRDRVRYHHF++G+CSC DFW Sbjct: 503 TNPGATIRVIKNLRVCEDCHSATKLIFKVFKRDIIVRDRVRYHHFRNGKCSCNDFW 558 >emb|CBI16436.3| unnamed protein product [Vitis vinifera] Length = 545 Score = 100 bits (248), Expect = 3e-19 Identities = 42/56 (75%), Positives = 47/56 (83%) Frame = -3 Query: 431 TEPGATIRVVKNLRVCGDCHSAIKIISRVYKRKIIVRDRVRYHHFKHGQCSCKDFW 264 T PG IR+VKNLRVC DCH A K IS+VYKR+IIVRDR+RYHHFK G CSCKD+W Sbjct: 490 TPPGTAIRIVKNLRVCADCHEATKFISKVYKREIIVRDRIRYHHFKDGFCSCKDYW 545 >ref|XP_002283117.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Vitis vinifera] Length = 624 Score = 100 bits (248), Expect = 3e-19 Identities = 42/56 (75%), Positives = 47/56 (83%) Frame = -3 Query: 431 TEPGATIRVVKNLRVCGDCHSAIKIISRVYKRKIIVRDRVRYHHFKHGQCSCKDFW 264 T PG IR+VKNLRVC DCH A K IS+VYKR+IIVRDR+RYHHFK G CSCKD+W Sbjct: 569 TPPGTAIRIVKNLRVCADCHEATKFISKVYKREIIVRDRIRYHHFKDGFCSCKDYW 624 >emb|CAN80267.1| hypothetical protein VITISV_027683 [Vitis vinifera] Length = 539 Score = 100 bits (248), Expect = 3e-19 Identities = 42/56 (75%), Positives = 47/56 (83%) Frame = -3 Query: 431 TEPGATIRVVKNLRVCGDCHSAIKIISRVYKRKIIVRDRVRYHHFKHGQCSCKDFW 264 T PG IR+VKNLRVC DCH A K IS+VYKR+IIVRDR+RYHHFK G CSCKD+W Sbjct: 484 TPPGTAIRIVKNLRVCADCHEATKFISKVYKREIIVRDRIRYHHFKDGFCSCKDYW 539 >ref|XP_006382375.1| hypothetical protein POPTR_0005s01560g [Populus trichocarpa] gi|550337735|gb|ERP60172.1| hypothetical protein POPTR_0005s01560g [Populus trichocarpa] Length = 545 Score = 99.8 bits (247), Expect = 3e-19 Identities = 43/56 (76%), Positives = 48/56 (85%) Frame = -3 Query: 431 TEPGATIRVVKNLRVCGDCHSAIKIISRVYKRKIIVRDRVRYHHFKHGQCSCKDFW 264 T+PG TI VVKNLR+C DCHSA K+IS+VY R+IIVRDR RYHHFK G CSCKDFW Sbjct: 490 TKPGTTIHVVKNLRMCEDCHSAFKLISQVYDREIIVRDRARYHHFKTGTCSCKDFW 545 >ref|XP_002330082.1| predicted protein [Populus trichocarpa] Length = 665 Score = 99.8 bits (247), Expect = 3e-19 Identities = 43/56 (76%), Positives = 48/56 (85%) Frame = -3 Query: 431 TEPGATIRVVKNLRVCGDCHSAIKIISRVYKRKIIVRDRVRYHHFKHGQCSCKDFW 264 T+PG TI VVKNLR+C DCHSA K+IS+VY R+IIVRDR RYHHFK G CSCKDFW Sbjct: 610 TKPGTTIHVVKNLRMCEDCHSAFKLISQVYDREIIVRDRARYHHFKTGTCSCKDFW 665 >ref|XP_004514991.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Cicer arietinum] Length = 690 Score = 99.4 bits (246), Expect = 5e-19 Identities = 42/56 (75%), Positives = 46/56 (82%) Frame = -3 Query: 431 TEPGATIRVVKNLRVCGDCHSAIKIISRVYKRKIIVRDRVRYHHFKHGQCSCKDFW 264 TEPG IR+VKNLRVCGDCH A K IS+VY R I+VRDR RYHHFK G CSCKD+W Sbjct: 635 TEPGTPIRIVKNLRVCGDCHQATKFISKVYDRVIVVRDRTRYHHFKDGICSCKDYW 690 >ref|XP_002270940.2| PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Vitis vinifera] Length = 640 Score = 99.4 bits (246), Expect = 5e-19 Identities = 42/56 (75%), Positives = 49/56 (87%) Frame = -3 Query: 431 TEPGATIRVVKNLRVCGDCHSAIKIISRVYKRKIIVRDRVRYHHFKHGQCSCKDFW 264 T PG+TIR+VKNLRVC DCH AIK+ISR YKR+IIVRDR R+HHF +G CSCKD+W Sbjct: 585 TAPGSTIRIVKNLRVCDDCHIAIKLISRTYKRRIIVRDRNRFHHFVNGSCSCKDYW 640 >ref|XP_003635359.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like, partial [Vitis vinifera] Length = 115 Score = 99.4 bits (246), Expect = 5e-19 Identities = 42/56 (75%), Positives = 49/56 (87%) Frame = -3 Query: 431 TEPGATIRVVKNLRVCGDCHSAIKIISRVYKRKIIVRDRVRYHHFKHGQCSCKDFW 264 T PG+TIR+VKNLRVC DCH AIK+ISR YKR+IIVRDR R+HHF +G CSCKD+W Sbjct: 60 TAPGSTIRIVKNLRVCDDCHIAIKLISRTYKRRIIVRDRNRFHHFVNGSCSCKDYW 115 >emb|CBI41082.3| unnamed protein product [Vitis vinifera] Length = 413 Score = 99.4 bits (246), Expect = 5e-19 Identities = 42/56 (75%), Positives = 49/56 (87%) Frame = -3 Query: 431 TEPGATIRVVKNLRVCGDCHSAIKIISRVYKRKIIVRDRVRYHHFKHGQCSCKDFW 264 T PG+TIR+VKNLRVC DCH AIK+ISR YKR+IIVRDR R+HHF +G CSCKD+W Sbjct: 358 TAPGSTIRIVKNLRVCDDCHIAIKLISRTYKRRIIVRDRNRFHHFVNGSCSCKDYW 413 >ref|XP_006443657.1| hypothetical protein CICLE_v10019256mg [Citrus clementina] gi|568853066|ref|XP_006480188.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like [Citrus sinensis] gi|557545919|gb|ESR56897.1| hypothetical protein CICLE_v10019256mg [Citrus clementina] Length = 642 Score = 98.6 bits (244), Expect = 8e-19 Identities = 38/56 (67%), Positives = 50/56 (89%) Frame = -3 Query: 431 TEPGATIRVVKNLRVCGDCHSAIKIISRVYKRKIIVRDRVRYHHFKHGQCSCKDFW 264 T PG T+R+VKNLR+C DCHS++K+IS++YKRKIIVRDR R+HHF++G CSC D+W Sbjct: 587 TNPGTTLRIVKNLRICEDCHSSLKLISKIYKRKIIVRDRKRFHHFENGSCSCMDYW 642 >gb|EOY07940.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] Length = 756 Score = 98.6 bits (244), Expect = 8e-19 Identities = 38/54 (70%), Positives = 49/54 (90%) Frame = -3 Query: 425 PGATIRVVKNLRVCGDCHSAIKIISRVYKRKIIVRDRVRYHHFKHGQCSCKDFW 264 PG T+R++KNLRVCGDCHSA K++S +Y+R+IIVRD +R+HHFK+G CSCKDFW Sbjct: 703 PGETLRIMKNLRVCGDCHSAFKLLSEMYRREIIVRDAIRFHHFKNGSCSCKDFW 756 >gb|EOY17244.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 646 Score = 98.2 bits (243), Expect = 1e-18 Identities = 39/56 (69%), Positives = 50/56 (89%) Frame = -3 Query: 431 TEPGATIRVVKNLRVCGDCHSAIKIISRVYKRKIIVRDRVRYHHFKHGQCSCKDFW 264 T PG T+R+VKNLRVC DCHS+IK+IS++YKRKIIVRD+ R+HHF++G CSC D+W Sbjct: 591 TSPGTTLRIVKNLRVCEDCHSSIKLISKIYKRKIIVRDQKRFHHFENGSCSCMDYW 646 >ref|XP_004304899.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 673 Score = 98.2 bits (243), Expect = 1e-18 Identities = 41/56 (73%), Positives = 50/56 (89%) Frame = -3 Query: 431 TEPGATIRVVKNLRVCGDCHSAIKIISRVYKRKIIVRDRVRYHHFKHGQCSCKDFW 264 T+PG TIRVVKNLR+C DCHSAIK+ S++ R IIVRDR+RYHHF++G+CSCKDFW Sbjct: 618 TKPGTTIRVVKNLRICEDCHSAIKLFSQLDNRDIIVRDRMRYHHFRNGRCSCKDFW 673 >ref|XP_004958944.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Setaria italica] Length = 594 Score = 97.4 bits (241), Expect = 2e-18 Identities = 40/54 (74%), Positives = 47/54 (87%) Frame = -3 Query: 425 PGATIRVVKNLRVCGDCHSAIKIISRVYKRKIIVRDRVRYHHFKHGQCSCKDFW 264 PG IR+VKNLRVCGDCH AIK+IS++Y R+IIVRDR R+HHFK G CSCKD+W Sbjct: 541 PGTPIRIVKNLRVCGDCHMAIKLISKIYDREIIVRDRSRFHHFKGGSCSCKDYW 594 >ref|XP_004288820.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Fragaria vesca subsp. vesca] Length = 659 Score = 97.4 bits (241), Expect = 2e-18 Identities = 42/56 (75%), Positives = 47/56 (83%) Frame = -3 Query: 431 TEPGATIRVVKNLRVCGDCHSAIKIISRVYKRKIIVRDRVRYHHFKHGQCSCKDFW 264 T PG TIRVVKNLRVC DCH+A K+IS+VY R+IIVRDR R+H FK G CSCKDFW Sbjct: 604 TNPGTTIRVVKNLRVCSDCHTATKLISKVYNREIIVRDRNRFHQFKDGSCSCKDFW 659