BLASTX nr result
ID: Rehmannia23_contig00029043
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00029043 (722 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW22658.1| hypothetical protein PHAVU_005G171300g [Phaseolus... 41 6e-06 >gb|ESW22658.1| hypothetical protein PHAVU_005G171300g [Phaseolus vulgaris] Length = 971 Score = 41.2 bits (95), Expect(2) = 6e-06 Identities = 28/66 (42%), Positives = 37/66 (56%), Gaps = 11/66 (16%) Frame = +1 Query: 274 GIVPERVDFSEE----FSIHLENPQVISGNQIWAELEPIWASGY-WSWFYRVQVA----- 423 G + F+EE F I LENP VI+ NQIWA + P+ SGY ++ YR + + Sbjct: 443 GTLSPMESFAEELKLDFPIRLENPHVITPNQIWAGVVPVGPSGYTFNSSYRTRDSLQYKQ 502 Query: 424 -LGNAI 438 LGNAI Sbjct: 503 DLGNAI 508 Score = 35.4 bits (80), Expect(2) = 6e-06 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +2 Query: 482 STTIWERMCMNKLSAVEPRQSSVFSLAI 565 S +IW+R+C +K +EPR+SS F L+I Sbjct: 544 SMSIWDRICKHKKPVIEPRESSSFPLSI 571