BLASTX nr result
ID: Rehmannia23_contig00027364
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00027364 (585 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004252926.1| PREDICTED: uncharacterized protein LOC101267... 56 6e-06 >ref|XP_004252926.1| PREDICTED: uncharacterized protein LOC101267790 [Solanum lycopersicum] Length = 766 Score = 56.2 bits (134), Expect = 6e-06 Identities = 35/75 (46%), Positives = 40/75 (53%), Gaps = 3/75 (4%) Frame = +3 Query: 369 STPPAXXXXXXXXXXXXGHAHLKQEISNFITSSTAEIVAADHHR--KQRSQSISPQRAPR 542 STPPA GHA LK E+S +++ D HR +QRS SISPQR PR Sbjct: 13 STPPAEELLKKIQELEAGHAQLKHEMS--------KLMMCDDHRTQRQRSHSISPQRPPR 64 Query: 543 WRTGGG-DGSLAAAW 584 R GGG DG AA W Sbjct: 65 IRAGGGFDGGSAAVW 79