BLASTX nr result
ID: Rehmannia23_contig00024208
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00024208 (364 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001275467.1| 1,4-alpha-glucan-branching enzyme 2-2, chlor... 58 1e-06 emb|CAB40748.1| starch branching enzyme II [Solanum tuberosum] 58 1e-06 emb|CAB40749.1| starch branching enzyme II [Solanum tuberosum] 58 1e-06 emb|CAB40743.1| starch branching enzyme II [Solanum tuberosum] 55 7e-06 >ref|NP_001275467.1| 1,4-alpha-glucan-branching enzyme 2-2, chloroplastic/amyloplastic-like [Solanum tuberosum] gi|4584509|emb|CAB40746.1| starch branching enzyme II [Solanum tuberosum] Length = 878 Score = 58.2 bits (139), Expect = 1e-06 Identities = 31/52 (59%), Positives = 38/52 (73%) Frame = +1 Query: 208 MVYTLPGVRLPTVPSAYKLSSNGWSSHVDTRNAHLSFLVKNKSNTRKIFSGK 363 MVYTL GVR PTVPS YK SNG+SS+ D RNA++S +K S +RKI + K Sbjct: 1 MVYTLSGVRFPTVPSVYK--SNGFSSNGDRRNANISVFLKKHSLSRKILAEK 50 >emb|CAB40748.1| starch branching enzyme II [Solanum tuberosum] Length = 882 Score = 57.8 bits (138), Expect = 1e-06 Identities = 31/52 (59%), Positives = 38/52 (73%) Frame = +1 Query: 208 MVYTLPGVRLPTVPSAYKLSSNGWSSHVDTRNAHLSFLVKNKSNTRKIFSGK 363 MVYTL GVR PTVPS YK SNG+SS+ D RNA++S +K S +RKI + K Sbjct: 1 MVYTLSGVRFPTVPSVYK--SNGFSSNGDRRNANVSVFLKKHSLSRKILAEK 50 >emb|CAB40749.1| starch branching enzyme II [Solanum tuberosum] Length = 433 Score = 57.8 bits (138), Expect = 1e-06 Identities = 31/52 (59%), Positives = 38/52 (73%) Frame = +1 Query: 208 MVYTLPGVRLPTVPSAYKLSSNGWSSHVDTRNAHLSFLVKNKSNTRKIFSGK 363 MVYTL GVR PTVPS YK SNG+SS+ D RNA++S +K S +RKI + K Sbjct: 1 MVYTLSGVRFPTVPSVYK--SNGFSSNGDRRNANVSVFLKKHSLSRKILAEK 50 >emb|CAB40743.1| starch branching enzyme II [Solanum tuberosum] Length = 871 Score = 55.5 bits (132), Expect = 7e-06 Identities = 30/52 (57%), Positives = 37/52 (71%) Frame = +1 Query: 208 MVYTLPGVRLPTVPSAYKLSSNGWSSHVDTRNAHLSFLVKNKSNTRKIFSGK 363 MVY L GVR PTVPS YK SNG+SS+ D RNA++S +K S +RKI + K Sbjct: 1 MVYILSGVRFPTVPSVYK--SNGFSSNGDRRNANVSVFLKKHSLSRKILAEK 50