BLASTX nr result
ID: Rehmannia23_contig00023885
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00023885 (371 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004493880.1| PREDICTED: pleiotropic drug resistance prote... 69 8e-10 gb|EOY26604.1| Pleiotropic drug resistance 12 [Theobroma cacao] 66 4e-09 gb|EMT20966.1| Pleiotropic drug resistance protein 4 [Aegilops t... 65 9e-09 gb|EMT17622.1| Pleiotropic drug resistance protein 4 [Aegilops t... 65 9e-09 gb|EMS67193.1| Pleiotropic drug resistance protein 4 [Triticum u... 65 9e-09 gb|EMS61936.1| Pleiotropic drug resistance protein 4 [Triticum u... 65 9e-09 gb|AEY84030.1| ABCG3, partial [Triticum aestivum] 65 9e-09 dbj|BAK01114.1| predicted protein [Hordeum vulgare subsp. vulgare] 65 9e-09 dbj|BAJ99663.1| predicted protein [Hordeum vulgare subsp. vulgare] 65 9e-09 gb|ESW34862.1| hypothetical protein PHAVU_001G187800g [Phaseolus... 65 1e-08 gb|ESW34861.1| hypothetical protein PHAVU_001G187700g [Phaseolus... 65 1e-08 ref|XP_002303856.2| hypothetical protein POPTR_0003s18140g [Popu... 65 1e-08 gb|EPS69014.1| hypothetical protein M569_05753, partial [Genlise... 65 1e-08 gb|EOY19081.1| Pleiotropic drug resistance 6 [Theobroma cacao] 65 1e-08 dbj|BAD05827.1| putative PDR-like ABC transporter [Oryza sativa ... 64 2e-08 ref|XP_002512728.1| ATP-binding cassette transporter, putative [... 64 2e-08 gb|EEE68613.1| hypothetical protein OsJ_27150 [Oryza sativa Japo... 64 2e-08 gb|EEC83509.1| hypothetical protein OsI_29079 [Oryza sativa Indi... 64 2e-08 ref|NP_001061702.1| Os08g0384500 [Oryza sativa Japonica Group] g... 64 2e-08 dbj|BAO45894.1| pleiotropic drug resistance ABC transporter [Aca... 64 3e-08 >ref|XP_004493880.1| PREDICTED: pleiotropic drug resistance protein 1-like [Cicer arietinum] Length = 1416 Score = 68.6 bits (166), Expect = 8e-10 Identities = 29/34 (85%), Positives = 34/34 (100%) Frame = -1 Query: 371 QNDIHSPNVTVYESLVYSAWLRLPQEVNAETRKV 270 QNDIHSPN+TVYESLVYSAWLRLP+++NAETRK+ Sbjct: 898 QNDIHSPNITVYESLVYSAWLRLPEDINAETRKM 931 >gb|EOY26604.1| Pleiotropic drug resistance 12 [Theobroma cacao] Length = 1463 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -1 Query: 371 QNDIHSPNVTVYESLVYSAWLRLPQEVNAETRKV 270 QNDIHSP+VTVYESL+YSAWLRLP EVNAETRK+ Sbjct: 955 QNDIHSPHVTVYESLLYSAWLRLPAEVNAETRKM 988 >gb|EMT20966.1| Pleiotropic drug resistance protein 4 [Aegilops tauschii] Length = 2086 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 371 QNDIHSPNVTVYESLVYSAWLRLPQEVNAETRKV 270 QNDIHSPNVTVYESLVYSAWLRLP +V +ETRK+ Sbjct: 883 QNDIHSPNVTVYESLVYSAWLRLPSDVESETRKM 916 >gb|EMT17622.1| Pleiotropic drug resistance protein 4 [Aegilops tauschii] Length = 1512 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 371 QNDIHSPNVTVYESLVYSAWLRLPQEVNAETRKV 270 QNDIHSPNVTVYESLVYSAWLRLP +V +ETRK+ Sbjct: 1006 QNDIHSPNVTVYESLVYSAWLRLPSDVESETRKM 1039 >gb|EMS67193.1| Pleiotropic drug resistance protein 4 [Triticum urartu] Length = 1462 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 371 QNDIHSPNVTVYESLVYSAWLRLPQEVNAETRKV 270 QNDIHSPNVTVYESLVYSAWLRLP +V +ETRK+ Sbjct: 956 QNDIHSPNVTVYESLVYSAWLRLPSDVESETRKM 989 >gb|EMS61936.1| Pleiotropic drug resistance protein 4 [Triticum urartu] Length = 1443 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 371 QNDIHSPNVTVYESLVYSAWLRLPQEVNAETRKV 270 QNDIHSPNVTVYESLVYSAWLRLP +V +ETRK+ Sbjct: 937 QNDIHSPNVTVYESLVYSAWLRLPSDVESETRKM 970 >gb|AEY84030.1| ABCG3, partial [Triticum aestivum] Length = 144 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 371 QNDIHSPNVTVYESLVYSAWLRLPQEVNAETRKV 270 QNDIHSPNVTVYESLVYSAWLRLP +V +ETRK+ Sbjct: 49 QNDIHSPNVTVYESLVYSAWLRLPSDVESETRKM 82 >dbj|BAK01114.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 1447 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 371 QNDIHSPNVTVYESLVYSAWLRLPQEVNAETRKV 270 QNDIHSPNVTVYESLVYSAWLRLP +V +ETRK+ Sbjct: 941 QNDIHSPNVTVYESLVYSAWLRLPSDVESETRKM 974 >dbj|BAJ99663.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 1469 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 371 QNDIHSPNVTVYESLVYSAWLRLPQEVNAETRKV 270 QNDIHSPNVTVYESLVYSAWLRLP +V +ETRK+ Sbjct: 936 QNDIHSPNVTVYESLVYSAWLRLPSDVESETRKM 969 >gb|ESW34862.1| hypothetical protein PHAVU_001G187800g [Phaseolus vulgaris] Length = 1419 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -1 Query: 371 QNDIHSPNVTVYESLVYSAWLRLPQEVNAETRKV 270 QNDIHSPNVTVYESL++SAWLRLP +VNA+TRK+ Sbjct: 910 QNDIHSPNVTVYESLLFSAWLRLPSDVNAQTRKM 943 >gb|ESW34861.1| hypothetical protein PHAVU_001G187700g [Phaseolus vulgaris] Length = 1442 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -1 Query: 371 QNDIHSPNVTVYESLVYSAWLRLPQEVNAETRKV 270 QNDIHSPNVTVYESL++SAWLRLP +VNA+TRK+ Sbjct: 933 QNDIHSPNVTVYESLLFSAWLRLPSDVNAQTRKM 966 >ref|XP_002303856.2| hypothetical protein POPTR_0003s18140g [Populus trichocarpa] gi|550343433|gb|EEE78835.2| hypothetical protein POPTR_0003s18140g [Populus trichocarpa] Length = 1400 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 371 QNDIHSPNVTVYESLVYSAWLRLPQEVNAETRKV 270 QNDIHSP+VTVYESL+YS WLRLP EVNAETRK+ Sbjct: 923 QNDIHSPHVTVYESLLYSGWLRLPPEVNAETRKM 956 >gb|EPS69014.1| hypothetical protein M569_05753, partial [Genlisea aurea] Length = 693 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 371 QNDIHSPNVTVYESLVYSAWLRLPQEVNAETRKV 270 Q DIHSPNVTVYESLVYSAWLRLP+EV+A+TRK+ Sbjct: 188 QTDIHSPNVTVYESLVYSAWLRLPKEVDADTRKM 221 >gb|EOY19081.1| Pleiotropic drug resistance 6 [Theobroma cacao] Length = 1503 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -1 Query: 371 QNDIHSPNVTVYESLVYSAWLRLPQEVNAETRK 273 QNDIHSP+VTVYESLVYSAWLRL +EVNAETRK Sbjct: 974 QNDIHSPHVTVYESLVYSAWLRLAKEVNAETRK 1006 >dbj|BAD05827.1| putative PDR-like ABC transporter [Oryza sativa Japonica Group] Length = 1489 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 371 QNDIHSPNVTVYESLVYSAWLRLPQEVNAETRKV 270 QNDIHSPNVTVYESL YSAWLRLP +V++ETRK+ Sbjct: 983 QNDIHSPNVTVYESLAYSAWLRLPSDVDSETRKM 1016 >ref|XP_002512728.1| ATP-binding cassette transporter, putative [Ricinus communis] gi|223547739|gb|EEF49231.1| ATP-binding cassette transporter, putative [Ricinus communis] Length = 1429 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -1 Query: 371 QNDIHSPNVTVYESLVYSAWLRLPQEVNAETRKV 270 QNDIHSP+VTVYESL+YS+WLRLP EVN+ETRK+ Sbjct: 924 QNDIHSPHVTVYESLLYSSWLRLPPEVNSETRKM 957 >gb|EEE68613.1| hypothetical protein OsJ_27150 [Oryza sativa Japonica Group] Length = 1199 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 371 QNDIHSPNVTVYESLVYSAWLRLPQEVNAETRKV 270 QNDIHSPNVTVYESL YSAWLRLP +V++ETRK+ Sbjct: 693 QNDIHSPNVTVYESLAYSAWLRLPSDVDSETRKM 726 >gb|EEC83509.1| hypothetical protein OsI_29079 [Oryza sativa Indica Group] Length = 1356 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 371 QNDIHSPNVTVYESLVYSAWLRLPQEVNAETRKV 270 QNDIHSPNVTVYESL YSAWLRLP +V++ETRK+ Sbjct: 850 QNDIHSPNVTVYESLAYSAWLRLPSDVDSETRKM 883 >ref|NP_001061702.1| Os08g0384500 [Oryza sativa Japonica Group] gi|113623671|dbj|BAF23616.1| Os08g0384500, partial [Oryza sativa Japonica Group] Length = 763 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 371 QNDIHSPNVTVYESLVYSAWLRLPQEVNAETRKV 270 QNDIHSPNVTVYESL YSAWLRLP +V++ETRK+ Sbjct: 257 QNDIHSPNVTVYESLAYSAWLRLPSDVDSETRKM 290 >dbj|BAO45894.1| pleiotropic drug resistance ABC transporter [Acacia mangium] Length = 1433 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/34 (82%), Positives = 34/34 (100%) Frame = -1 Query: 371 QNDIHSPNVTVYESLVYSAWLRLPQEVNAETRKV 270 QNDIHSP+VTVYESLVYSAWLRLPQEV+++TR++ Sbjct: 927 QNDIHSPHVTVYESLVYSAWLRLPQEVDSKTREM 960