BLASTX nr result
ID: Rehmannia23_contig00022012
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00022012 (597 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS69165.1| hypothetical protein M569_05603, partial [Genlise... 74 2e-11 >gb|EPS69165.1| hypothetical protein M569_05603, partial [Genlisea aurea] Length = 470 Score = 74.3 bits (181), Expect = 2e-11 Identities = 50/114 (43%), Positives = 65/114 (57%), Gaps = 1/114 (0%) Frame = -2 Query: 341 SSRFMSPLIQSNSTPIPTPNTSDRRSKSAHRRQPSKTDENLIPETNRSLDKSSATTESTV 162 SSRFM+PL+ SN TP P+ RSKSA R+Q + DEN IP +LDKS + S+ Sbjct: 23 SSRFMTPLVHSNQTPKPSDFP---RSKSAGRQQSLRIDENHIP----NLDKSGSV--SSP 73 Query: 161 QKTQHQQ-RVKQHTKENGESKDHQHSHVRVSSRPDTRIAIGTERVVPSRYRQVP 3 + +H R K KE+GE K++Q R +P T I T R V SRYR+ P Sbjct: 74 GRIKHLNLRFKNSLKESGEVKENQCYESRFQLKPGTPIPTATNRTVQSRYRKAP 127