BLASTX nr result
ID: Rehmannia23_contig00017439
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00017439 (580 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514747.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 >ref|XP_002514747.1| conserved hypothetical protein [Ricinus communis] gi|223546351|gb|EEF47853.1| conserved hypothetical protein [Ricinus communis] Length = 92 Score = 57.0 bits (136), Expect = 3e-06 Identities = 37/92 (40%), Positives = 49/92 (53%) Frame = -2 Query: 540 MAGNALHLFVTILAFSFLASLIGLSNSRAINLVHERQGIPSPEDTLQMNKAENPGGNMEI 361 MAG L L V L S L L + +R L H Q + E T + K +N + Sbjct: 1 MAGTFLRLLVLFLGISNLICLNAIPITRIGRLTHGPQVLTVSETTHMVAKDKN------L 54 Query: 360 VENEVIHGRMDFEINRDYPGSGANNRHTPYPP 265 E+E + R+ E+N DYPGSGAN+RHTP+PP Sbjct: 55 EEHENLEERIAAELN-DYPGSGANHRHTPWPP 85