BLASTX nr result
ID: Rehmannia23_contig00015941
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00015941 (317 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004237196.1| PREDICTED: 1-phosphatidylinositol 3-phosphat... 55 1e-05 >ref|XP_004237196.1| PREDICTED: 1-phosphatidylinositol 3-phosphate 5-kinase-like [Solanum lycopersicum] Length = 1615 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -2 Query: 130 DEMIQGEENDVNITPLERHPSAASILSDKIDSAWSGTDLAP 8 D+ ++GE N VN TPLER PSA S+LSD+IDSAW+GTD +P Sbjct: 1062 DKHMEGE-NAVNGTPLERAPSAGSVLSDQIDSAWTGTDRSP 1101