BLASTX nr result
ID: Rehmannia23_contig00014955
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00014955 (327 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN64002.1| hypothetical protein VITISV_023116 [Vitis vinifera] 61 1e-07 >emb|CAN64002.1| hypothetical protein VITISV_023116 [Vitis vinifera] Length = 1211 Score = 61.2 bits (147), Expect = 1e-07 Identities = 35/60 (58%), Positives = 37/60 (61%) Frame = +1 Query: 1 IRIMSTNLRGPSFSCTARTLKTLDDDLEVKFPHFPLELLGLAITVYLRRPTEVKATVFAI 180 IRIMST+LRGPSFSCTA TLK L +DLE HFP E L LRR E K AI Sbjct: 1118 IRIMSTSLRGPSFSCTAWTLKNLGEDLEANMLHFPCETLVPVAKPNLRRQXEGKLKECAI 1177