BLASTX nr result
ID: Rehmannia23_contig00014952
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00014952 (351 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACG45465.1| phospholipid hydroperoxide glutathione peroxidase... 117 2e-24 gb|ACF84693.1| unknown [Zea mays] gi|413923369|gb|AFW63301.1| gl... 117 2e-24 ref|NP_001105091.1| GP protein [Zea mays] gi|22268405|gb|AAM8884... 117 2e-24 gb|EMT04066.1| Putative phospholipid hydroperoxide glutathione p... 116 3e-24 ref|XP_006647645.1| PREDICTED: probable phospholipid hydroperoxi... 116 4e-24 ref|XP_004953380.1| PREDICTED: probable phospholipid hydroperoxi... 116 4e-24 ref|XP_002454515.1| hypothetical protein SORBIDRAFT_04g032520 [S... 116 4e-24 ref|XP_002303583.2| glutathione peroxidase family protein [Popul... 116 4e-24 dbj|BAC55016.1| phospholipid hydroperoxide glutathione peroxidas... 115 6e-24 dbj|BAJ84899.1| predicted protein [Hordeum vulgare subsp. vulgar... 115 6e-24 emb|CAB59893.1| GPX12Hv, glutathione peroxidase-like protein [Ho... 115 6e-24 ref|NP_001047659.1| Os02g0664000 [Oryza sativa Japonica Group] g... 115 8e-24 ref|XP_003570046.1| PREDICTED: probable phospholipid hydroperoxi... 115 8e-24 gb|EAY86982.1| hypothetical protein OsI_08376 [Oryza sativa Indi... 115 8e-24 ref|XP_006827674.1| hypothetical protein AMTR_s00009p00255140 [A... 114 1e-23 ref|XP_006652625.1| PREDICTED: probable phospholipid hydroperoxi... 114 1e-23 gb|AFA36624.1| glutathione peroxidase-like protein, partial [Lol... 114 1e-23 ref|NP_001141210.1| putative glutathione peroxidase [Zea mays] g... 114 2e-23 gb|EEC77777.1| hypothetical protein OsI_16938 [Oryza sativa Indi... 114 2e-23 gb|ACG39625.1| phospholipid hydroperoxide glutathione peroxidase... 114 2e-23 >gb|ACG45465.1| phospholipid hydroperoxide glutathione peroxidase [Zea mays] Length = 246 Score = 117 bits (293), Expect = 2e-24 Identities = 54/62 (87%), Positives = 59/62 (95%) Frame = +1 Query: 1 FDKVEVNGPNTAPIYKYMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEK 180 FDKV+VNG NTAPIYK++KS KGSLFGDNIKWNFSKFLVDKEG +V+RYAPTTSPLSIEK Sbjct: 178 FDKVDVNGDNTAPIYKFLKSSKGSLFGDNIKWNFSKFLVDKEGHVVERYAPTTSPLSIEK 237 Query: 181 DI 186 DI Sbjct: 238 DI 239 >gb|ACF84693.1| unknown [Zea mays] gi|413923369|gb|AFW63301.1| glutathione peroxidase [Zea mays] Length = 246 Score = 117 bits (293), Expect = 2e-24 Identities = 54/62 (87%), Positives = 59/62 (95%) Frame = +1 Query: 1 FDKVEVNGPNTAPIYKYMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEK 180 FDKV+VNG NTAPIYK++KS KGSLFGDNIKWNFSKFLVDKEG +V+RYAPTTSPLSIEK Sbjct: 178 FDKVDVNGDNTAPIYKFLKSSKGSLFGDNIKWNFSKFLVDKEGHVVERYAPTTSPLSIEK 237 Query: 181 DI 186 DI Sbjct: 238 DI 239 >ref|NP_001105091.1| GP protein [Zea mays] gi|22268405|gb|AAM88847.2|AF520911_1 putative glutathione peroxidase [Zea mays] Length = 168 Score = 117 bits (293), Expect = 2e-24 Identities = 54/62 (87%), Positives = 59/62 (95%) Frame = +1 Query: 1 FDKVEVNGPNTAPIYKYMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEK 180 FDKV+VNG NTAPIYK++KS KGSLFGDNIKWNFSKFLVDKEG +V+RYAPTTSPLSIEK Sbjct: 100 FDKVDVNGDNTAPIYKFLKSSKGSLFGDNIKWNFSKFLVDKEGHVVERYAPTTSPLSIEK 159 Query: 181 DI 186 DI Sbjct: 160 DI 161 >gb|EMT04066.1| Putative phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial [Aegilops tauschii] Length = 169 Score = 116 bits (291), Expect = 3e-24 Identities = 53/62 (85%), Positives = 58/62 (93%) Frame = +1 Query: 1 FDKVEVNGPNTAPIYKYMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEK 180 FDKV+VNG N AP+YK++KS KGSLFGDNIKWNFSKFLVDKEG +VDRYAPTTSPLSIEK Sbjct: 101 FDKVDVNGDNVAPVYKFLKSSKGSLFGDNIKWNFSKFLVDKEGHVVDRYAPTTSPLSIEK 160 Query: 181 DI 186 DI Sbjct: 161 DI 162 >ref|XP_006647645.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial-like [Oryza brachyantha] Length = 236 Score = 116 bits (290), Expect = 4e-24 Identities = 53/62 (85%), Positives = 59/62 (95%) Frame = +1 Query: 1 FDKVEVNGPNTAPIYKYMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEK 180 FDKV+VNG NTAPIYK++KS KG LFGDNIKWNFSKFLVDKEG++V+RYAPTTSPLSIEK Sbjct: 168 FDKVDVNGDNTAPIYKFLKSSKGGLFGDNIKWNFSKFLVDKEGRVVERYAPTTSPLSIEK 227 Query: 181 DI 186 DI Sbjct: 228 DI 229 >ref|XP_004953380.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial-like [Setaria italica] Length = 240 Score = 116 bits (290), Expect = 4e-24 Identities = 53/62 (85%), Positives = 60/62 (96%) Frame = +1 Query: 1 FDKVEVNGPNTAPIYKYMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEK 180 FDKV+VNG NTAPIYK++KS KGSLFG+NIKWNFSKFLVDKEG++V+RYAPTTSPLSIEK Sbjct: 172 FDKVDVNGDNTAPIYKFLKSSKGSLFGENIKWNFSKFLVDKEGRVVERYAPTTSPLSIEK 231 Query: 181 DI 186 DI Sbjct: 232 DI 233 >ref|XP_002454515.1| hypothetical protein SORBIDRAFT_04g032520 [Sorghum bicolor] gi|241934346|gb|EES07491.1| hypothetical protein SORBIDRAFT_04g032520 [Sorghum bicolor] Length = 251 Score = 116 bits (290), Expect = 4e-24 Identities = 53/62 (85%), Positives = 60/62 (96%) Frame = +1 Query: 1 FDKVEVNGPNTAPIYKYMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEK 180 FDKV+VNG NTAPIYK++KS KGSLFG+NIKWNFSKFLVDKEG++V+RYAPTTSPLSIEK Sbjct: 180 FDKVDVNGDNTAPIYKFLKSSKGSLFGENIKWNFSKFLVDKEGRVVERYAPTTSPLSIEK 239 Query: 181 DI 186 DI Sbjct: 240 DI 241 >ref|XP_002303583.2| glutathione peroxidase family protein [Populus trichocarpa] gi|118485257|gb|ABK94488.1| unknown [Populus trichocarpa] gi|550343047|gb|EEE78562.2| glutathione peroxidase family protein [Populus trichocarpa] Length = 238 Score = 116 bits (290), Expect = 4e-24 Identities = 53/62 (85%), Positives = 58/62 (93%) Frame = +1 Query: 1 FDKVEVNGPNTAPIYKYMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEK 180 FDKVEVNG N APIYKY+KS KG LFGDNIKWNFSKFLVDKEG++VDRYAPTTSPLSIEK Sbjct: 170 FDKVEVNGNNAAPIYKYLKSSKGGLFGDNIKWNFSKFLVDKEGKVVDRYAPTTSPLSIEK 229 Query: 181 DI 186 ++ Sbjct: 230 EV 231 >dbj|BAC55016.1| phospholipid hydroperoxide glutathione peroxidase-like protein [Hordeum vulgare] Length = 169 Score = 115 bits (288), Expect = 6e-24 Identities = 52/62 (83%), Positives = 58/62 (93%) Frame = +1 Query: 1 FDKVEVNGPNTAPIYKYMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEK 180 FDKV+VNG N AP+YK++KS KGSLFGDNIKWNFSKFLVDK+G +VDRYAPTTSPLSIEK Sbjct: 101 FDKVDVNGDNVAPVYKFLKSSKGSLFGDNIKWNFSKFLVDKDGNVVDRYAPTTSPLSIEK 160 Query: 181 DI 186 DI Sbjct: 161 DI 162 >dbj|BAJ84899.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326508822|dbj|BAJ86804.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 237 Score = 115 bits (288), Expect = 6e-24 Identities = 52/62 (83%), Positives = 58/62 (93%) Frame = +1 Query: 1 FDKVEVNGPNTAPIYKYMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEK 180 FDKV+VNG N AP+YK++KS KGSLFGDNIKWNFSKFLVDK+G +VDRYAPTTSPLSIEK Sbjct: 169 FDKVDVNGDNVAPVYKFLKSSKGSLFGDNIKWNFSKFLVDKDGNVVDRYAPTTSPLSIEK 228 Query: 181 DI 186 DI Sbjct: 229 DI 230 >emb|CAB59893.1| GPX12Hv, glutathione peroxidase-like protein [Hordeum vulgare subsp. vulgare] Length = 237 Score = 115 bits (288), Expect = 6e-24 Identities = 52/62 (83%), Positives = 58/62 (93%) Frame = +1 Query: 1 FDKVEVNGPNTAPIYKYMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEK 180 FDKV+VNG N AP+YK++KS KGSLFGDNIKWNFSKFLVDK+G +VDRYAPTTSPLSIEK Sbjct: 169 FDKVDVNGDNVAPVYKFLKSSKGSLFGDNIKWNFSKFLVDKDGNVVDRYAPTTSPLSIEK 228 Query: 181 DI 186 DI Sbjct: 229 DI 230 >ref|NP_001047659.1| Os02g0664000 [Oryza sativa Japonica Group] gi|50251353|dbj|BAD28380.1| putative glutathione peroxidase [Oryza sativa Japonica Group] gi|113537190|dbj|BAF09573.1| Os02g0664000 [Oryza sativa Japonica Group] gi|215765002|dbj|BAG86699.1| unnamed protein product [Oryza sativa Japonica Group] gi|222623394|gb|EEE57526.1| hypothetical protein OsJ_07838 [Oryza sativa Japonica Group] Length = 238 Score = 115 bits (287), Expect = 8e-24 Identities = 52/62 (83%), Positives = 59/62 (95%) Frame = +1 Query: 1 FDKVEVNGPNTAPIYKYMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEK 180 FDKV+VNG NTAPIYK++KS KG LFGDNIKWNFSKFLVDKEG++V+RYAPTTSPLS+EK Sbjct: 170 FDKVDVNGDNTAPIYKFLKSSKGGLFGDNIKWNFSKFLVDKEGRVVERYAPTTSPLSMEK 229 Query: 181 DI 186 DI Sbjct: 230 DI 231 >ref|XP_003570046.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial-like [Brachypodium distachyon] Length = 240 Score = 115 bits (287), Expect = 8e-24 Identities = 51/62 (82%), Positives = 58/62 (93%) Frame = +1 Query: 1 FDKVEVNGPNTAPIYKYMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEK 180 FDKV+VNG N APIYK++KS KGS+FGDNIKWNFSKFL+DKEG +VDRYAPTTSPLSIEK Sbjct: 172 FDKVDVNGENVAPIYKFLKSSKGSIFGDNIKWNFSKFLIDKEGHVVDRYAPTTSPLSIEK 231 Query: 181 DI 186 D+ Sbjct: 232 DL 233 >gb|EAY86982.1| hypothetical protein OsI_08376 [Oryza sativa Indica Group] Length = 238 Score = 115 bits (287), Expect = 8e-24 Identities = 52/62 (83%), Positives = 59/62 (95%) Frame = +1 Query: 1 FDKVEVNGPNTAPIYKYMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEK 180 FDKV+VNG NTAPIYK++KS KG LFGDNIKWNFSKFLVDKEG++V+RYAPTTSPLS+EK Sbjct: 170 FDKVDVNGDNTAPIYKFLKSSKGGLFGDNIKWNFSKFLVDKEGRVVERYAPTTSPLSMEK 229 Query: 181 DI 186 DI Sbjct: 230 DI 231 >ref|XP_006827674.1| hypothetical protein AMTR_s00009p00255140 [Amborella trichopoda] gi|548832294|gb|ERM95090.1| hypothetical protein AMTR_s00009p00255140 [Amborella trichopoda] Length = 254 Score = 114 bits (286), Expect = 1e-23 Identities = 52/62 (83%), Positives = 56/62 (90%) Frame = +1 Query: 1 FDKVEVNGPNTAPIYKYMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEK 180 FDKVEVNG N P+YK++KS KG LFGDNIKWNFSKFLVDKEG +VDRYAPTTSPLSIEK Sbjct: 186 FDKVEVNGDNATPVYKFLKSSKGGLFGDNIKWNFSKFLVDKEGHVVDRYAPTTSPLSIEK 245 Query: 181 DI 186 DI Sbjct: 246 DI 247 >ref|XP_006652625.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial-like [Oryza brachyantha] Length = 168 Score = 114 bits (285), Expect = 1e-23 Identities = 52/62 (83%), Positives = 58/62 (93%) Frame = +1 Query: 1 FDKVEVNGPNTAPIYKYMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEK 180 FDKV+VNG N AP+YKY+KS KG LFGD+IKWNFSKFLVDKEG++VDRYAPTTSPLSIEK Sbjct: 100 FDKVDVNGSNAAPLYKYLKSNKGGLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPLSIEK 159 Query: 181 DI 186 DI Sbjct: 160 DI 161 >gb|AFA36624.1| glutathione peroxidase-like protein, partial [Lolium perenne] Length = 109 Score = 114 bits (285), Expect = 1e-23 Identities = 51/62 (82%), Positives = 59/62 (95%) Frame = +1 Query: 1 FDKVEVNGPNTAPIYKYMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEK 180 FDKV+VNG N APIYK++K+ KGSLFGDNIKWNFSKFLVDKEG++VDRYAPTTSPL+IEK Sbjct: 41 FDKVDVNGDNVAPIYKFLKTSKGSLFGDNIKWNFSKFLVDKEGRVVDRYAPTTSPLNIEK 100 Query: 181 DI 186 D+ Sbjct: 101 DL 102 >ref|NP_001141210.1| putative glutathione peroxidase [Zea mays] gi|48374955|gb|AAT42154.1| putative glutathione peroxidase [Zea mays] gi|194703274|gb|ACF85721.1| unknown [Zea mays] gi|195622840|gb|ACG33250.1| phospholipid hydroperoxide glutathione peroxidase [Zea mays] gi|223975959|gb|ACN32167.1| unknown [Zea mays] gi|414585925|tpg|DAA36496.1| TPA: glutathione peroxidase isoform 1 [Zea mays] gi|414585926|tpg|DAA36497.1| TPA: glutathione peroxidase isoform 2 [Zea mays] Length = 168 Score = 114 bits (284), Expect = 2e-23 Identities = 52/62 (83%), Positives = 58/62 (93%) Frame = +1 Query: 1 FDKVEVNGPNTAPIYKYMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEK 180 FDKV+VNG N APIYK++KS KG LFGD+IKWNFSKFLVDKEG++VDRYAPTTSPLSIEK Sbjct: 100 FDKVDVNGSNAAPIYKFLKSSKGGLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPLSIEK 159 Query: 181 DI 186 DI Sbjct: 160 DI 161 >gb|EEC77777.1| hypothetical protein OsI_16938 [Oryza sativa Indica Group] Length = 168 Score = 114 bits (284), Expect = 2e-23 Identities = 52/62 (83%), Positives = 58/62 (93%) Frame = +1 Query: 1 FDKVEVNGPNTAPIYKYMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEK 180 FDKV+VNG N AP+YKY+KS KG LFGD+IKWNFSKFLVDKEG++VDRYAPTTSPLSIEK Sbjct: 100 FDKVDVNGNNAAPLYKYLKSNKGGLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPLSIEK 159 Query: 181 DI 186 DI Sbjct: 160 DI 161 >gb|ACG39625.1| phospholipid hydroperoxide glutathione peroxidase [Zea mays] Length = 168 Score = 114 bits (284), Expect = 2e-23 Identities = 52/62 (83%), Positives = 58/62 (93%) Frame = +1 Query: 1 FDKVEVNGPNTAPIYKYMKSVKGSLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEK 180 FDKV+VNG N APIYK++KS KG LFGD+IKWNFSKFLVDKEG++VDRYAPTTSPLSIEK Sbjct: 100 FDKVDVNGSNAAPIYKFLKSSKGGLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPLSIEK 159 Query: 181 DI 186 DI Sbjct: 160 DI 161