BLASTX nr result
ID: Rehmannia23_contig00013957
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00013957 (349 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275393.1| PREDICTED: transcription factor bHLH144 isof... 55 1e-05 emb|CAN76054.1| hypothetical protein VITISV_036406 [Vitis vinifera] 55 1e-05 >ref|XP_002275393.1| PREDICTED: transcription factor bHLH144 isoform 2 [Vitis vinifera] gi|225463440|ref|XP_002275365.1| PREDICTED: transcription factor bHLH144 isoform 1 [Vitis vinifera] Length = 244 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = -3 Query: 347 GGNQMSTVAVLDEAVRYLKSLKMDMQKMGIRNSK 246 G +QM+TVAVLDEAVRYLKSLK+++QK+G+ NSK Sbjct: 208 GSSQMNTVAVLDEAVRYLKSLKVEVQKLGVSNSK 241 >emb|CAN76054.1| hypothetical protein VITISV_036406 [Vitis vinifera] Length = 289 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = -3 Query: 347 GGNQMSTVAVLDEAVRYLKSLKMDMQKMGIRNSK 246 G +QM+TVAVLDEAVRYLKSLK+++QK+G+ NSK Sbjct: 253 GSSQMNTVAVLDEAVRYLKSLKVEVQKLGVSNSK 286