BLASTX nr result
ID: Rehmannia23_contig00011388
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00011388 (571 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS69916.1| hypothetical protein M569_04846, partial [Genlise... 64 3e-08 ref|XP_002306739.2| hypothetical protein POPTR_0005s22370g [Popu... 59 1e-06 gb|EMJ18250.1| hypothetical protein PRUPE_ppa001327mg [Prunus pe... 57 3e-06 ref|XP_006360001.1| PREDICTED: protein MEI2-like 2-like [Solanum... 57 4e-06 ref|XP_002279792.2| PREDICTED: protein MEI2-like 2-like [Vitis v... 57 4e-06 emb|CBI31752.3| unnamed protein product [Vitis vinifera] 57 4e-06 ref|XP_002302143.2| hypothetical protein POPTR_0002s06070g [Popu... 56 6e-06 ref|XP_006348953.1| PREDICTED: protein MEI2-like 2-like isoform ... 56 7e-06 ref|XP_006348952.1| PREDICTED: protein MEI2-like 2-like isoform ... 56 7e-06 >gb|EPS69916.1| hypothetical protein M569_04846, partial [Genlisea aurea] Length = 452 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -3 Query: 566 DLEPFPYGNLNIFIRQPDGSYAGDSLDSPTGDLDE 462 DL+ FP GNLNIFIRQPDGSYAGDSLDSP D DE Sbjct: 418 DLDGFPSGNLNIFIRQPDGSYAGDSLDSPKSDCDE 452 >ref|XP_002306739.2| hypothetical protein POPTR_0005s22370g [Populus trichocarpa] gi|550339528|gb|EEE93735.2| hypothetical protein POPTR_0005s22370g [Populus trichocarpa] Length = 854 Score = 58.5 bits (140), Expect = 1e-06 Identities = 28/37 (75%), Positives = 29/37 (78%) Frame = -3 Query: 566 DLEPFPYGNLNIFIRQPDGSYAGDSLDSPTGDLDEKL 456 D EPF GNLNI IRQPDGSY+GDSLD P LDEKL Sbjct: 815 DQEPFLSGNLNICIRQPDGSYSGDSLDCPEDSLDEKL 851 >gb|EMJ18250.1| hypothetical protein PRUPE_ppa001327mg [Prunus persica] Length = 853 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/36 (77%), Positives = 28/36 (77%) Frame = -3 Query: 566 DLEPFPYGNLNIFIRQPDGSYAGDSLDSPTGDLDEK 459 D E F NLNI IRQPDGSY GDSLDSP GDLDEK Sbjct: 814 DQETFLSRNLNICIRQPDGSYLGDSLDSPKGDLDEK 849 >ref|XP_006360001.1| PREDICTED: protein MEI2-like 2-like [Solanum tuberosum] Length = 849 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -3 Query: 566 DLEPFPYGNLNIFIRQPDGSYAGDSLDSPTGDLD 465 D E P NLNI IR+PDGSY+GDSLDSPTGDLD Sbjct: 806 DEETLPSSNLNICIRRPDGSYSGDSLDSPTGDLD 839 >ref|XP_002279792.2| PREDICTED: protein MEI2-like 2-like [Vitis vinifera] Length = 842 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -3 Query: 566 DLEPFPYGNLNIFIRQPDGSYAGDSLDSPTGDLDE 462 D EPF GNLNI IRQPDGSY+GDSL+SP G+L++ Sbjct: 808 DQEPFASGNLNICIRQPDGSYSGDSLESPKGNLED 842 >emb|CBI31752.3| unnamed protein product [Vitis vinifera] Length = 245 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -3 Query: 566 DLEPFPYGNLNIFIRQPDGSYAGDSLDSPTGDLDE 462 D EPF GNLNI IRQPDGSY+GDSL+SP G+L++ Sbjct: 211 DQEPFASGNLNICIRQPDGSYSGDSLESPKGNLED 245 >ref|XP_002302143.2| hypothetical protein POPTR_0002s06070g [Populus trichocarpa] gi|550344379|gb|EEE81416.2| hypothetical protein POPTR_0002s06070g [Populus trichocarpa] Length = 828 Score = 56.2 bits (134), Expect = 6e-06 Identities = 27/36 (75%), Positives = 27/36 (75%) Frame = -3 Query: 566 DLEPFPYGNLNIFIRQPDGSYAGDSLDSPTGDLDEK 459 D EPF GNLNI IRQPDGSY GDS DSP LDEK Sbjct: 789 DQEPFLSGNLNICIRQPDGSYFGDSFDSPEDSLDEK 824 >ref|XP_006348953.1| PREDICTED: protein MEI2-like 2-like isoform X2 [Solanum tuberosum] Length = 831 Score = 55.8 bits (133), Expect = 7e-06 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = -3 Query: 566 DLEPFPYGNLNIFIRQPDGSYAGDSLDSPTGDLDEKL 456 D E P NLNI +R PDGSY+GDSLDSP DLDEKL Sbjct: 792 DQELLPTNNLNICVRLPDGSYSGDSLDSPNSDLDEKL 828 >ref|XP_006348952.1| PREDICTED: protein MEI2-like 2-like isoform X1 [Solanum tuberosum] Length = 840 Score = 55.8 bits (133), Expect = 7e-06 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = -3 Query: 566 DLEPFPYGNLNIFIRQPDGSYAGDSLDSPTGDLDEKL 456 D E P NLNI +R PDGSY+GDSLDSP DLDEKL Sbjct: 801 DQELLPTNNLNICVRLPDGSYSGDSLDSPNSDLDEKL 837