BLASTX nr result
ID: Rehmannia23_contig00011084
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00011084 (352 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS68910.1| hypothetical protein M569_05860, partial [Genlise... 55 7e-06 >gb|EPS68910.1| hypothetical protein M569_05860, partial [Genlisea aurea] Length = 180 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/52 (55%), Positives = 39/52 (75%), Gaps = 1/52 (1%) Frame = -3 Query: 344 LSEDEQMSL-TSAKGWPSSAVFIEGTSPIHPIPVTGGQVKIQDNEDSANDTS 192 LS+D+QMSL +S+KGWPSS FIEG I PIPV ++K++DNE+ +D S Sbjct: 132 LSDDQQMSLNSSSKGWPSSVFFIEG---ISPIPVMEMEMKVRDNEEKPDDDS 180