BLASTX nr result
ID: Rehmannia23_contig00009180
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00009180 (331 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799... 59 7e-07 ref|XP_006473551.1| PREDICTED: uncharacterized protein LOC102624... 58 1e-06 >ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799960 [Glycine max] gi|356564302|ref|XP_003550394.1| PREDICTED: uncharacterized protein LOC100799844 [Glycine max] gi|561034189|gb|ESW32719.1| hypothetical protein PHAVU_001G011900g [Phaseolus vulgaris] Length = 41 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +2 Query: 242 MSPVLSEILRSGFMINSALRRRTHLVQSFS 331 MSPVLSEILRSGFMINS+LRRRTHLVQSFS Sbjct: 1 MSPVLSEILRSGFMINSSLRRRTHLVQSFS 30 >ref|XP_006473551.1| PREDICTED: uncharacterized protein LOC102624295 [Citrus sinensis] gi|508722951|gb|EOY14848.1| Peptide upstream open reading frame 5 [Theobroma cacao] Length = 41 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +2 Query: 242 MSPVLSEILRSGFMINSALRRRTHLVQSFS 331 MSPV+SEILRSGFMINS+LRRRTHLVQSFS Sbjct: 1 MSPVVSEILRSGFMINSSLRRRTHLVQSFS 30