BLASTX nr result
ID: Rehmannia23_contig00008463
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00008463 (512 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006341449.1| PREDICTED: staphylococcal nuclease domain-co... 60 2e-07 ref|XP_004235861.1| PREDICTED: staphylococcal nuclease domain-co... 60 2e-07 gb|EPS63110.1| hypothetical protein M569_11676, partial [Genlise... 60 3e-07 ref|XP_006341451.1| PREDICTED: staphylococcal nuclease domain-co... 58 1e-06 ref|XP_004235862.1| PREDICTED: staphylococcal nuclease domain-co... 58 1e-06 emb|CAB87924.1| putative protein [Arabidopsis thaliana] 56 4e-06 ref|XP_006399219.1| hypothetical protein EUTSA_v10012565mg [Eutr... 56 4e-06 ref|NP_200986.1| TUDOR-SN protein 2 [Arabidopsis thaliana] gi|10... 56 4e-06 ref|NP_001154697.2| TUDOR-SN protein 1 [Arabidopsis thaliana] gi... 56 4e-06 ref|XP_002873305.1| tudor domain-containing protein [Arabidopsis... 56 4e-06 dbj|BAF01856.1| 100 kDa coactivator - like protein [Arabidopsis ... 56 4e-06 ref|NP_196352.2| TUDOR-SN protein 1 [Arabidopsis thaliana] gi|18... 56 4e-06 ref|XP_006436995.1| hypothetical protein CICLE_v10030606mg [Citr... 55 7e-06 ref|XP_006436994.1| hypothetical protein CICLE_v10030606mg [Citr... 55 7e-06 ref|XP_006286992.1| hypothetical protein CARUB_v10000137mg [Caps... 55 1e-05 ref|XP_006282301.1| hypothetical protein CARUB_v10028588mg [Caps... 55 1e-05 ref|XP_002864755.1| tudor domain-containing protein [Arabidopsis... 55 1e-05 >ref|XP_006341449.1| PREDICTED: staphylococcal nuclease domain-containing protein 1-like isoform X1 [Solanum tuberosum] gi|565348924|ref|XP_006341450.1| PREDICTED: staphylococcal nuclease domain-containing protein 1-like isoform X2 [Solanum tuberosum] Length = 978 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 510 RQLALDELEKFQTEAREKRLGMWEYGDIASDDED 409 +Q ALDELEK+QTEAREKR MWEYGD+ SD+ED Sbjct: 935 KQQALDELEKYQTEAREKRFAMWEYGDVESDEED 968 >ref|XP_004235861.1| PREDICTED: staphylococcal nuclease domain-containing protein 1-like [Solanum lycopersicum] Length = 978 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 510 RQLALDELEKFQTEAREKRLGMWEYGDIASDDED 409 +Q ALDELEK+QTEAREKR MWEYGD+ SD+ED Sbjct: 935 KQQALDELEKYQTEAREKRFAMWEYGDVESDEED 968 >gb|EPS63110.1| hypothetical protein M569_11676, partial [Genlisea aurea] Length = 981 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 510 RQLALDELEKFQTEAREKRLGMWEYGDIASDDED 409 RQ+ LDELEK++ EAR RLGMWEYGDIASD+ED Sbjct: 937 RQVILDELEKYEAEARRNRLGMWEYGDIASDEED 970 >ref|XP_006341451.1| PREDICTED: staphylococcal nuclease domain-containing protein 1-like isoform X1 [Solanum tuberosum] gi|565348928|ref|XP_006341452.1| PREDICTED: staphylococcal nuclease domain-containing protein 1-like isoform X2 [Solanum tuberosum] Length = 978 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -3 Query: 510 RQLALDELEKFQTEAREKRLGMWEYGDIASDDED 409 +Q ALDELEK QTEAREKR MWEYGD+ SD+ED Sbjct: 935 KQQALDELEKHQTEAREKRRAMWEYGDVESDEED 968 >ref|XP_004235862.1| PREDICTED: staphylococcal nuclease domain-containing protein 1-like [Solanum lycopersicum] Length = 978 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -3 Query: 510 RQLALDELEKFQTEAREKRLGMWEYGDIASDDED 409 +Q ALDELEK QTEAREKR MWEYGD+ SD+ED Sbjct: 935 KQEALDELEKHQTEAREKRRAMWEYGDVESDEED 968 >emb|CAB87924.1| putative protein [Arabidopsis thaliana] Length = 1051 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -3 Query: 510 RQLALDELEKFQTEAREKRLGMWEYGDIASDDED 409 +Q ALD LEKFQ EAR+ R+G+W+YGDI SDDED Sbjct: 951 KQAALDALEKFQEEARKSRIGIWQYGDIESDDED 984 >ref|XP_006399219.1| hypothetical protein EUTSA_v10012565mg [Eutrema salsugineum] gi|557100309|gb|ESQ40672.1| hypothetical protein EUTSA_v10012565mg [Eutrema salsugineum] Length = 990 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -3 Query: 510 RQLALDELEKFQTEAREKRLGMWEYGDIASDDED 409 +Q ALD LEKFQ EAR+ R G+WEYGDI SDDED Sbjct: 945 KQAALDALEKFQEEARKSRTGIWEYGDIQSDDED 978 >ref|NP_200986.1| TUDOR-SN protein 2 [Arabidopsis thaliana] gi|10176871|dbj|BAB10078.1| transcription factor-like protein [Arabidopsis thaliana] gi|25083258|gb|AAN72055.1| 100 kDa coactivator - like protein [Arabidopsis thaliana] gi|332010134|gb|AED97517.1| TUDOR-SN protein 2 [Arabidopsis thaliana] Length = 985 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -3 Query: 510 RQLALDELEKFQTEAREKRLGMWEYGDIASDDED 409 +Q ALD LEKFQ EAR+ R G+WEYGDI SDDED Sbjct: 942 KQAALDALEKFQDEARKSRTGIWEYGDIQSDDED 975 >ref|NP_001154697.2| TUDOR-SN protein 1 [Arabidopsis thaliana] gi|332003758|gb|AED91141.1| TUDOR-SN protein 1 [Arabidopsis thaliana] Length = 1007 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -3 Query: 510 RQLALDELEKFQTEAREKRLGMWEYGDIASDDED 409 +Q ALD LEKFQ EAR+ R+G+W+YGDI SDDED Sbjct: 946 KQAALDALEKFQEEARKSRIGIWQYGDIESDDED 979 >ref|XP_002873305.1| tudor domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297319142|gb|EFH49564.1| tudor domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 990 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -3 Query: 510 RQLALDELEKFQTEAREKRLGMWEYGDIASDDED 409 +Q ALD LEKFQ EAR+ R+G+W+YGDI SDDED Sbjct: 945 KQAALDALEKFQEEARKSRIGIWQYGDIESDDED 978 >dbj|BAF01856.1| 100 kDa coactivator - like protein [Arabidopsis thaliana] Length = 612 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -3 Query: 510 RQLALDELEKFQTEAREKRLGMWEYGDIASDDED 409 +Q ALD LEKFQ EAR+ R G+WEYGDI SDDED Sbjct: 569 KQAALDALEKFQDEARKSRTGIWEYGDIQSDDED 602 >ref|NP_196352.2| TUDOR-SN protein 1 [Arabidopsis thaliana] gi|18086332|gb|AAL57629.1| AT5g07350/T2I1_60 [Arabidopsis thaliana] gi|332003757|gb|AED91140.1| TUDOR-SN protein 1 [Arabidopsis thaliana] Length = 991 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -3 Query: 510 RQLALDELEKFQTEAREKRLGMWEYGDIASDDED 409 +Q ALD LEKFQ EAR+ R+G+W+YGDI SDDED Sbjct: 946 KQAALDALEKFQEEARKSRIGIWQYGDIESDDED 979 >ref|XP_006436995.1| hypothetical protein CICLE_v10030606mg [Citrus clementina] gi|557539191|gb|ESR50235.1| hypothetical protein CICLE_v10030606mg [Citrus clementina] Length = 944 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -3 Query: 510 RQLALDELEKFQTEAREKRLGMWEYGDIASDDED 409 RQ AL+ LEKFQ EA+ R+GMW+YGDI SDDED Sbjct: 897 RQAALENLEKFQEEAKTARIGMWQYGDIQSDDED 930 >ref|XP_006436994.1| hypothetical protein CICLE_v10030606mg [Citrus clementina] gi|568863227|ref|XP_006485058.1| PREDICTED: staphylococcal nuclease domain-containing protein 1-like [Citrus sinensis] gi|557539190|gb|ESR50234.1| hypothetical protein CICLE_v10030606mg [Citrus clementina] Length = 1020 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -3 Query: 510 RQLALDELEKFQTEAREKRLGMWEYGDIASDDED 409 RQ AL+ LEKFQ EA+ R+GMW+YGDI SDDED Sbjct: 973 RQAALENLEKFQEEAKTARIGMWQYGDIQSDDED 1006 >ref|XP_006286992.1| hypothetical protein CARUB_v10000137mg [Capsella rubella] gi|482555698|gb|EOA19890.1| hypothetical protein CARUB_v10000137mg [Capsella rubella] Length = 991 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -3 Query: 510 RQLALDELEKFQTEAREKRLGMWEYGDIASDDED 409 +Q ALD LEKFQ EAR+ R G+W+YGDI SDDED Sbjct: 946 KQAALDALEKFQDEARKSRTGIWQYGDIQSDDED 979 >ref|XP_006282301.1| hypothetical protein CARUB_v10028588mg [Capsella rubella] gi|482551005|gb|EOA15199.1| hypothetical protein CARUB_v10028588mg [Capsella rubella] Length = 983 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -3 Query: 510 RQLALDELEKFQTEAREKRLGMWEYGDIASDDED 409 +Q ALD LEKFQ EAR+ R+G+W+YGDI SDDED Sbjct: 940 KQDALDALEKFQDEARKSRIGIWQYGDIQSDDED 973 >ref|XP_002864755.1| tudor domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297310590|gb|EFH41014.1| tudor domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 983 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -3 Query: 510 RQLALDELEKFQTEAREKRLGMWEYGDIASDDED 409 +Q ALD LEKFQ EAR+ R G+W+YGDI SDDED Sbjct: 940 KQAALDALEKFQDEARKSRTGIWQYGDIQSDDED 973