BLASTX nr result
ID: Rehmannia23_contig00008041
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00008041 (362 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006379099.1| ADP family protein [Populus trichocarpa] gi|... 61 1e-07 prf||1908224A nucleotide translocator 61 2e-07 ref|NP_196853.1| ADP/ATP carrier protein 2 [Arabidopsis thaliana... 61 2e-07 ref|XP_006439128.1| hypothetical protein CICLE_v10033595mg [Citr... 61 2e-07 gb|AFX72760.1| ATP/ADP carrier protein, partial [Litchi chinensis] 61 2e-07 ref|XP_006287927.1| hypothetical protein CARUB_v10001162mg [Caps... 61 2e-07 ref|XP_002871570.1| hypothetical protein ARALYDRAFT_488169 [Arab... 61 2e-07 ref|XP_002517886.1| ADP,ATP carrier protein, putative [Ricinus c... 61 2e-07 ref|XP_002531911.1| ADP,ATP carrier protein, putative [Ricinus c... 61 2e-07 ref|XP_002299948.1| adenine nucleotide translocator family prote... 61 2e-07 gb|AAL15894.1|AF417306_1 putative adenine nucleotide translocase... 61 2e-07 emb|CAA48579.1| adenosine nucleotide translocator [Arabidopsis t... 61 2e-07 ref|XP_004306529.1| PREDICTED: ADP,ATP carrier protein 1, mitoch... 60 3e-07 sp|O22342.1|ADT1_GOSHI RecName: Full=ADP,ATP carrier protein 1, ... 60 3e-07 ref|XP_006654224.1| PREDICTED: ADP,ATP carrier protein, mitochon... 60 4e-07 ref|XP_006367480.1| PREDICTED: ADP,ATP carrier protein 3, mitoch... 60 4e-07 gb|ESW05832.1| hypothetical protein PHAVU_011G213200g [Phaseolus... 60 4e-07 ref|XP_002310404.2| hypothetical protein POPTR_0007s01010g [Popu... 60 4e-07 gb|EPS71896.1| hypothetical protein M569_02862, partial [Genlise... 60 4e-07 ref|XP_004985877.1| PREDICTED: ADP,ATP carrier protein 2, mitoch... 60 4e-07 >ref|XP_006379099.1| ADP family protein [Populus trichocarpa] gi|550331187|gb|ERP56896.1| ADP family protein [Populus trichocarpa] Length = 385 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 AGANILRAIAGAGVLAGYDKLQLIVFGKKY 90 AGANILRAIAGAGVLAGYDKLQLIVFGKKY Sbjct: 351 AGANILRAIAGAGVLAGYDKLQLIVFGKKY 380 >prf||1908224A nucleotide translocator Length = 403 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 1 AGANILRAIAGAGVLAGYDKLQLIVFGKKY 90 AGANILRA+AGAGVLAGYDKLQLIVFGKKY Sbjct: 369 AGANILRAVAGAGVLAGYDKLQLIVFGKKY 398 >ref|NP_196853.1| ADP/ATP carrier protein 2 [Arabidopsis thaliana] gi|79327788|ref|NP_001031876.1| ADP/ATP carrier protein 2 [Arabidopsis thaliana] gi|21431738|sp|P40941.2|ADT2_ARATH RecName: Full=ADP,ATP carrier protein 2, mitochondrial; AltName: Full=ADP/ATP translocase 2; AltName: Full=Adenine nucleotide translocator 2; Short=ANT 2; Flags: Precursor gi|9955541|emb|CAC05426.1| adenosine nucleotide translocator [Arabidopsis thaliana] gi|15292847|gb|AAK92794.1| putative adenosine nucleotide translocator protein [Arabidopsis thaliana] gi|19310815|gb|AAL85138.1| putative adenosine nucleotide translocator protein [Arabidopsis thaliana] gi|222423949|dbj|BAH19937.1| AT5G13490 [Arabidopsis thaliana] gi|332004518|gb|AED91901.1| ADP/ATP carrier protein 2 [Arabidopsis thaliana] gi|332004519|gb|AED91902.1| ADP/ATP carrier protein 2 [Arabidopsis thaliana] Length = 385 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 1 AGANILRAIAGAGVLAGYDKLQLIVFGKKY 90 AGANILRA+AGAGVLAGYDKLQLIVFGKKY Sbjct: 351 AGANILRAVAGAGVLAGYDKLQLIVFGKKY 380 >ref|XP_006439128.1| hypothetical protein CICLE_v10033595mg [Citrus clementina] gi|568858709|ref|XP_006482889.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Citrus sinensis] gi|557541324|gb|ESR52368.1| hypothetical protein CICLE_v10033595mg [Citrus clementina] Length = 385 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 1 AGANILRAIAGAGVLAGYDKLQLIVFGKKY 90 AGANILRA+AGAGVLAGYDKLQLIVFGKKY Sbjct: 351 AGANILRAVAGAGVLAGYDKLQLIVFGKKY 380 >gb|AFX72760.1| ATP/ADP carrier protein, partial [Litchi chinensis] Length = 388 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 1 AGANILRAIAGAGVLAGYDKLQLIVFGKKY 90 AGANILRA+AGAGVLAGYDKLQLIVFGKKY Sbjct: 353 AGANILRAVAGAGVLAGYDKLQLIVFGKKY 382 >ref|XP_006287927.1| hypothetical protein CARUB_v10001162mg [Capsella rubella] gi|482556633|gb|EOA20825.1| hypothetical protein CARUB_v10001162mg [Capsella rubella] Length = 384 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 1 AGANILRAIAGAGVLAGYDKLQLIVFGKKY 90 AGAN+LRAIAGAGVLAGYDKLQLIVFGKKY Sbjct: 350 AGANVLRAIAGAGVLAGYDKLQLIVFGKKY 379 >ref|XP_002871570.1| hypothetical protein ARALYDRAFT_488169 [Arabidopsis lyrata subsp. lyrata] gi|297317407|gb|EFH47829.1| hypothetical protein ARALYDRAFT_488169 [Arabidopsis lyrata subsp. lyrata] Length = 384 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 1 AGANILRAIAGAGVLAGYDKLQLIVFGKKY 90 AGANILRA+AGAGVLAGYDKLQLIVFGKKY Sbjct: 350 AGANILRAVAGAGVLAGYDKLQLIVFGKKY 379 >ref|XP_002517886.1| ADP,ATP carrier protein, putative [Ricinus communis] gi|223542868|gb|EEF44404.1| ADP,ATP carrier protein, putative [Ricinus communis] Length = 379 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 1 AGANILRAIAGAGVLAGYDKLQLIVFGKKY 90 AGANILRA+AGAGVLAGYDKLQLIVFGKKY Sbjct: 344 AGANILRAVAGAGVLAGYDKLQLIVFGKKY 373 >ref|XP_002531911.1| ADP,ATP carrier protein, putative [Ricinus communis] gi|223528451|gb|EEF30484.1| ADP,ATP carrier protein, putative [Ricinus communis] Length = 385 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 1 AGANILRAIAGAGVLAGYDKLQLIVFGKKY 90 AGANILRA+AGAGVLAGYDKLQLIVFGKKY Sbjct: 351 AGANILRAVAGAGVLAGYDKLQLIVFGKKY 380 >ref|XP_002299948.1| adenine nucleotide translocator family protein [Populus trichocarpa] gi|222847206|gb|EEE84753.1| adenine nucleotide translocator family protein [Populus trichocarpa] Length = 389 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 1 AGANILRAIAGAGVLAGYDKLQLIVFGKKY 90 AGANILRA+AGAGVLAGYDKLQLIVFGKKY Sbjct: 355 AGANILRAVAGAGVLAGYDKLQLIVFGKKY 384 >gb|AAL15894.1|AF417306_1 putative adenine nucleotide translocase [Castanea sativa] Length = 125 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 1 AGANILRAIAGAGVLAGYDKLQLIVFGKKY 90 AGANILRA+AGAGVLAGYDKLQLIVFGKKY Sbjct: 91 AGANILRAVAGAGVLAGYDKLQLIVFGKKY 120 >emb|CAA48579.1| adenosine nucleotide translocator [Arabidopsis thaliana] Length = 385 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 1 AGANILRAIAGAGVLAGYDKLQLIVFGKKY 90 AGANILRA+AGAGVLAGYDKLQLIVFGKKY Sbjct: 351 AGANILRAVAGAGVLAGYDKLQLIVFGKKY 380 >ref|XP_004306529.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 385 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 1 AGANILRAIAGAGVLAGYDKLQLIVFGKKY 90 AGANILRAIAGAGVL+GYDKLQLIVFGKKY Sbjct: 351 AGANILRAIAGAGVLSGYDKLQLIVFGKKY 380 >sp|O22342.1|ADT1_GOSHI RecName: Full=ADP,ATP carrier protein 1, mitochondrial; AltName: Full=ADP/ATP translocase 1; AltName: Full=Adenine nucleotide translocator 1; Short=ANT 1; Flags: Precursor gi|2463664|gb|AAB72047.1| adenine nucleotide translocator 1 [Gossypium hirsutum] Length = 386 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 1 AGANILRAIAGAGVLAGYDKLQLIVFGKKY 90 AG+NILRAIAGAGVLAGYDKLQLIVFGKKY Sbjct: 352 AGSNILRAIAGAGVLAGYDKLQLIVFGKKY 381 >ref|XP_006654224.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Oryza brachyantha] Length = 379 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 1 AGANILRAIAGAGVLAGYDKLQLIVFGKKY 90 AGANILRA+AGAGVLAGYDKLQ+IVFGKKY Sbjct: 345 AGANILRAVAGAGVLAGYDKLQVIVFGKKY 374 >ref|XP_006367480.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Solanum tuberosum] Length = 384 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 1 AGANILRAIAGAGVLAGYDKLQLIVFGKKY 90 AGANILRA+AGAGVLAGYDKLQLI+FGKKY Sbjct: 349 AGANILRAVAGAGVLAGYDKLQLIMFGKKY 378 >gb|ESW05832.1| hypothetical protein PHAVU_011G213200g [Phaseolus vulgaris] Length = 385 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 1 AGANILRAIAGAGVLAGYDKLQLIVFGKKY 90 AGANILRA+AGAGVLAGYDKLQ+IVFGKKY Sbjct: 351 AGANILRAVAGAGVLAGYDKLQVIVFGKKY 380 >ref|XP_002310404.2| hypothetical protein POPTR_0007s01010g [Populus trichocarpa] gi|550333861|gb|EEE90854.2| hypothetical protein POPTR_0007s01010g [Populus trichocarpa] Length = 380 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 1 AGANILRAIAGAGVLAGYDKLQLIVFGKKY 90 AGANILRA+AGAGVLAGYDKLQ+IVFGKKY Sbjct: 345 AGANILRAVAGAGVLAGYDKLQVIVFGKKY 374 >gb|EPS71896.1| hypothetical protein M569_02862, partial [Genlisea aurea] Length = 316 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 1 AGANILRAIAGAGVLAGYDKLQLIVFGKKY 90 AGANILRA+AGAGVLAGYDKLQ+IVFGKKY Sbjct: 282 AGANILRAVAGAGVLAGYDKLQVIVFGKKY 311 >ref|XP_004985877.1| PREDICTED: ADP,ATP carrier protein 2, mitochondrial-like [Setaria italica] Length = 381 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 1 AGANILRAIAGAGVLAGYDKLQLIVFGKKY 90 AGANILRA+AGAGVLAGYDKLQ+IVFGKKY Sbjct: 347 AGANILRAVAGAGVLAGYDKLQVIVFGKKY 376