BLASTX nr result
ID: Rehmannia23_contig00008024
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00008024 (346 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004488843.1| PREDICTED: NAC domain-containing protein 21/... 49 5e-06 >ref|XP_004488843.1| PREDICTED: NAC domain-containing protein 21/22-like [Cicer arietinum] Length = 314 Score = 49.3 bits (116), Expect(2) = 5e-06 Identities = 23/42 (54%), Positives = 30/42 (71%) Frame = +1 Query: 100 IGNNDSSNYVIKAVLKGSPSFGEASPDSYLSEVGLSSMWNHY 225 + NN+++N LKGSPS GE S +SYLSEVG+ MWN+Y Sbjct: 276 LNNNNNNN---NQSLKGSPSLGEGSSESYLSEVGMPHMWNNY 314 Score = 26.6 bits (57), Expect(2) = 5e-06 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 6/37 (16%) Frame = +2 Query: 2 PCFSNFTSTQTSPNFSSL------INPSINNGTGIWG 94 PCFS F+ QT+P F+++ N + NN +G Sbjct: 204 PCFSIFSQNQTNPIFNNMEPKLPPYNNNNNNNANTFG 240