BLASTX nr result
ID: Rehmannia23_contig00003481
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00003481 (501 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006362997.1| PREDICTED: pentatricopeptide repeat-containi... 166 3e-39 ref|XP_004243565.1| PREDICTED: pentatricopeptide repeat-containi... 159 3e-37 gb|EPS73698.1| hypothetical protein M569_01057 [Genlisea aurea] 159 5e-37 gb|EOX93483.1| Tetratricopeptide repeat (TPR)-like superfamily p... 143 2e-32 ref|XP_006469492.1| PREDICTED: pentatricopeptide repeat-containi... 142 5e-32 ref|XP_004140069.1| PREDICTED: pentatricopeptide repeat-containi... 142 6e-32 ref|XP_002269867.1| PREDICTED: pentatricopeptide repeat-containi... 142 6e-32 ref|XP_006447772.1| hypothetical protein CICLE_v10018243mg [Citr... 141 1e-31 gb|EMJ17863.1| hypothetical protein PRUPE_ppb017187mg [Prunus pe... 140 2e-31 ref|XP_004303560.1| PREDICTED: pentatricopeptide repeat-containi... 139 3e-31 ref|XP_004510327.1| PREDICTED: pentatricopeptide repeat-containi... 131 1e-28 ref|XP_006843235.1| hypothetical protein AMTR_s00080p00074320 [A... 130 2e-28 ref|XP_006285690.1| hypothetical protein CARUB_v10007160mg [Caps... 130 2e-28 ref|XP_002530223.1| pentatricopeptide repeat-containing protein,... 129 3e-28 ref|XP_002869597.1| pentatricopeptide repeat-containing protein ... 129 4e-28 ref|NP_194398.1| pentatricopeptide repeat-containing protein [Ar... 127 2e-27 ref|XP_006413152.1| hypothetical protein EUTSA_v10024897mg [Eutr... 126 3e-27 ref|XP_003625044.1| Pentatricopeptide repeat-containing protein ... 123 2e-26 ref|XP_002320514.2| hypothetical protein POPTR_0014s16390g [Popu... 122 4e-26 ref|XP_003531640.1| PREDICTED: pentatricopeptide repeat-containi... 102 5e-20 >ref|XP_006362997.1| PREDICTED: pentatricopeptide repeat-containing protein At4g26680, mitochondrial-like [Solanum tuberosum] Length = 530 Score = 166 bits (420), Expect = 3e-39 Identities = 84/139 (60%), Positives = 104/139 (74%) Frame = -3 Query: 418 MKNLLQWSRFSTFLKPIKAHLKNPIEFSLPTNYKKNPILLPHRTMLPAIGQDLDFVNIVH 239 MK L Q +FSTF+ K + ++ P K +PI LPHRT+ GQDLDFVN+ H Sbjct: 1 MKILKQIRKFSTFIDSTKHTHQVFVKLITPKRSKLDPIPLPHRTISDPKGQDLDFVNVAH 60 Query: 238 SHLIHSEWDKLNKLASGLTPFRIKHILLKTRKDYVLSLEFFKWVELKNSELNTLDVISII 59 SHLIHS+W KL L+SGLTPFR+KHILLK +KDYVLSLEFFKWVE+K+ NTL+ SI+ Sbjct: 61 SHLIHSDWTKLENLSSGLTPFRVKHILLKIQKDYVLSLEFFKWVEVKSPNSNTLENHSIV 120 Query: 58 LHILTKNRKFISAESILRR 2 LH+LTK++KF SAESILR+ Sbjct: 121 LHVLTKSKKFKSAESILRK 139 >ref|XP_004243565.1| PREDICTED: pentatricopeptide repeat-containing protein At4g26680, mitochondrial-like [Solanum lycopersicum] Length = 530 Score = 159 bits (403), Expect = 3e-37 Identities = 82/139 (58%), Positives = 102/139 (73%) Frame = -3 Query: 418 MKNLLQWSRFSTFLKPIKAHLKNPIEFSLPTNYKKNPILLPHRTMLPAIGQDLDFVNIVH 239 MK L Q +FSTFL K + ++ K +PI LPHRT+ GQDLDFVN+ H Sbjct: 1 MKILKQIRKFSTFLDSTKNTHQVFVKSIATKQSKLDPIPLPHRTISEPKGQDLDFVNVAH 60 Query: 238 SHLIHSEWDKLNKLASGLTPFRIKHILLKTRKDYVLSLEFFKWVELKNSELNTLDVISII 59 SHL+HS+W KL L+SGLT FR+KHILLK +KDYVLSLEFFKWVE+K+ NTL+ SI+ Sbjct: 61 SHLVHSDWTKLENLSSGLTQFRVKHILLKIQKDYVLSLEFFKWVEVKSPNSNTLENHSIV 120 Query: 58 LHILTKNRKFISAESILRR 2 LH+LTK++KF SAESILR+ Sbjct: 121 LHVLTKSKKFKSAESILRK 139 >gb|EPS73698.1| hypothetical protein M569_01057 [Genlisea aurea] Length = 500 Score = 159 bits (401), Expect = 5e-37 Identities = 80/133 (60%), Positives = 104/133 (78%), Gaps = 1/133 (0%) Frame = -3 Query: 397 SRFSTFLKPIKAHLKNPIEFSLPTNY-KKNPILLPHRTMLPAIGQDLDFVNIVHSHLIHS 221 S F + + ++N +E SLP + +KN ILLPHRT+ A GQDLD VN+++SHLIHS Sbjct: 5 SHLRKFSQTKSSPVRNAVESSLPADRNRKNAILLPHRTLPTAKGQDLDAVNVIYSHLIHS 64 Query: 220 EWDKLNKLASGLTPFRIKHILLKTRKDYVLSLEFFKWVELKNSELNTLDVISIILHILTK 41 +WDKL++ S LTPFRIKH+LLK++KD+ L+ EFFKWVELKNS+L TLDV I LHILTK Sbjct: 65 DWDKLDESVSCLTPFRIKHVLLKSQKDHHLAFEFFKWVELKNSQLITLDVNCIALHILTK 124 Query: 40 NRKFISAESILRR 2 RKFISA+SI+++ Sbjct: 125 YRKFISAQSIIKK 137 >gb|EOX93483.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 532 Score = 143 bits (361), Expect = 2e-32 Identities = 73/138 (52%), Positives = 95/138 (68%) Frame = -3 Query: 418 MKNLLQWSRFSTFLKPIKAHLKNPIEFSLPTNYKKNPILLPHRTMLPAIGQDLDFVNIVH 239 M N +FST L +K P + PI +P RT+ GQDLDFVN+ H Sbjct: 1 MNNHFPGRQFSTLLDSVKL---KPFNDGISRRRNWYPIPIPFRTIPEPRGQDLDFVNVAH 57 Query: 238 SHLIHSEWDKLNKLASGLTPFRIKHILLKTRKDYVLSLEFFKWVELKNSELNTLDVISII 59 SHLIHS+WDKLN L++ LTPFR+KHILL+ +KD+VLSLEFF WV+ +N ++L+ S+I Sbjct: 58 SHLIHSDWDKLNALSTHLTPFRVKHILLRIQKDHVLSLEFFNWVQTQNPTSHSLETRSMI 117 Query: 58 LHILTKNRKFISAESILR 5 LHILT+N+KF SAES+LR Sbjct: 118 LHILTRNQKFKSAESVLR 135 >ref|XP_006469492.1| PREDICTED: pentatricopeptide repeat-containing protein At4g26680, mitochondrial-like isoform X1 [Citrus sinensis] gi|568830409|ref|XP_006469493.1| PREDICTED: pentatricopeptide repeat-containing protein At4g26680, mitochondrial-like isoform X2 [Citrus sinensis] gi|568830411|ref|XP_006469494.1| PREDICTED: pentatricopeptide repeat-containing protein At4g26680, mitochondrial-like isoform X3 [Citrus sinensis] Length = 565 Score = 142 bits (358), Expect = 5e-32 Identities = 78/141 (55%), Positives = 96/141 (68%), Gaps = 5/141 (3%) Frame = -3 Query: 412 NLLQWSRFSTFLKPIKAHLKNP--IEFSLPTNYKK---NPILLPHRTMLPAIGQDLDFVN 248 N+ + R ST + + KNP I S+ N K NPI +PHRT+ GQD DFVN Sbjct: 27 NVFPFRRLSTMVTTLD---KNPTFINPSVSENSMKMNRNPIPIPHRTLPEPKGQDFDFVN 83 Query: 247 IVHSHLIHSEWDKLNKLASGLTPFRIKHILLKTRKDYVLSLEFFKWVELKNSELNTLDVI 68 I +SHLIHS+W KL L++ LTPFR+KH+LLK +KDYVLSLEFF WV+ TL+ Sbjct: 84 ITYSHLIHSDWKKLTALSTHLTPFRVKHVLLKVQKDYVLSLEFFTWVQTHKPSSLTLETH 143 Query: 67 SIILHILTKNRKFISAESILR 5 SI+LHILTKNRKF S+ESILR Sbjct: 144 SIVLHILTKNRKFKSSESILR 164 >ref|XP_004140069.1| PREDICTED: pentatricopeptide repeat-containing protein At4g26680, mitochondrial-like [Cucumis sativus] gi|449528063|ref|XP_004171026.1| PREDICTED: pentatricopeptide repeat-containing protein At4g26680, mitochondrial-like [Cucumis sativus] Length = 536 Score = 142 bits (357), Expect = 6e-32 Identities = 77/137 (56%), Positives = 95/137 (69%), Gaps = 3/137 (2%) Frame = -3 Query: 406 LQWSRFSTFLKPIK---AHLKNPIEFSLPTNYKKNPILLPHRTMLPAIGQDLDFVNIVHS 236 L + RFST L + A + + SL ++ I +PHR++ G DLDFVN+VHS Sbjct: 4 LPFRRFSTLLGSVPRTYASISPKFDLSLGKR-NRDSIPIPHRSIPEPRGPDLDFVNVVHS 62 Query: 235 HLIHSEWDKLNKLASGLTPFRIKHILLKTRKDYVLSLEFFKWVELKNSELNTLDVISIIL 56 HLIHS+W KL+ L+ GLT FR+KHILLKT+KDYVLSLEFF WV +N +TL+ IIL Sbjct: 63 HLIHSDWSKLDCLSMGLTAFRVKHILLKTQKDYVLSLEFFNWVATQNPSSHTLETHCIIL 122 Query: 55 HILTKNRKFISAESILR 5 HILTK RKF SAESILR Sbjct: 123 HILTKRRKFKSAESILR 139 >ref|XP_002269867.1| PREDICTED: pentatricopeptide repeat-containing protein At4g26680, mitochondrial-like [Vitis vinifera] Length = 616 Score = 142 bits (357), Expect = 6e-32 Identities = 67/109 (61%), Positives = 86/109 (78%), Gaps = 2/109 (1%) Frame = -3 Query: 325 NYKK--NPILLPHRTMLPAIGQDLDFVNIVHSHLIHSEWDKLNKLASGLTPFRIKHILLK 152 NY + NPI +PHRT+ GQDLDFVN+ HSHLI+S+W KLN +++GLTP+R+KHI+LK Sbjct: 107 NYMRSWNPIPVPHRTIPEPRGQDLDFVNVAHSHLINSDWAKLNSMSTGLTPYRMKHIMLK 166 Query: 151 TRKDYVLSLEFFKWVELKNSELNTLDVISIILHILTKNRKFISAESILR 5 +KD+VLS EFF WV+ +N TL+ SIILHILTKN KF SAES+L+ Sbjct: 167 IKKDHVLSFEFFNWVKAQNPNCQTLETYSIILHILTKNHKFKSAESVLK 215 >ref|XP_006447772.1| hypothetical protein CICLE_v10018243mg [Citrus clementina] gi|557550383|gb|ESR61012.1| hypothetical protein CICLE_v10018243mg [Citrus clementina] Length = 565 Score = 141 bits (355), Expect = 1e-31 Identities = 78/141 (55%), Positives = 95/141 (67%), Gaps = 5/141 (3%) Frame = -3 Query: 412 NLLQWSRFSTFLKPIKAHLKNP--IEFSLPTNYKK---NPILLPHRTMLPAIGQDLDFVN 248 N+ R ST + + KNP I S+ N K NPI +PHRT+ GQD DFVN Sbjct: 27 NVFPLRRLSTMVTTLD---KNPTFINPSVSENSMKMNRNPIPIPHRTLPDPKGQDFDFVN 83 Query: 247 IVHSHLIHSEWDKLNKLASGLTPFRIKHILLKTRKDYVLSLEFFKWVELKNSELNTLDVI 68 I +SHLIHS+W KL L++ LTPFR+KH+LLK +KDYVLSLEFF WV+ TL+ Sbjct: 84 IAYSHLIHSDWKKLTALSTHLTPFRVKHVLLKVQKDYVLSLEFFTWVQTHKPSSLTLETH 143 Query: 67 SIILHILTKNRKFISAESILR 5 SI+LHILTKNRKF S+ESILR Sbjct: 144 SIVLHILTKNRKFKSSESILR 164 >gb|EMJ17863.1| hypothetical protein PRUPE_ppb017187mg [Prunus persica] Length = 533 Score = 140 bits (352), Expect = 2e-31 Identities = 68/104 (65%), Positives = 83/104 (79%) Frame = -3 Query: 313 NPILLPHRTMLPAIGQDLDFVNIVHSHLIHSEWDKLNKLASGLTPFRIKHILLKTRKDYV 134 NP+ +PHRT+ GQDLDFVN+ +SHLIHS+W KLN L++GLT FR+KHILLK ++DYV Sbjct: 37 NPLPIPHRTIPEPKGQDLDFVNVANSHLIHSDWAKLNSLSNGLTAFRVKHILLKLKQDYV 96 Query: 133 LSLEFFKWVELKNSELNTLDVISIILHILTKNRKFISAESILRR 2 LSLEFF WV +N TL+ S+ILHILTK RKF SAESILR+ Sbjct: 97 LSLEFFNWVAAQNPTSLTLETHSMILHILTKYRKFKSAESILRK 140 >ref|XP_004303560.1| PREDICTED: pentatricopeptide repeat-containing protein At4g26680, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 539 Score = 139 bits (351), Expect = 3e-31 Identities = 72/119 (60%), Positives = 87/119 (73%), Gaps = 6/119 (5%) Frame = -3 Query: 340 FSLPTNYKK------NPILLPHRTMLPAIGQDLDFVNIVHSHLIHSEWDKLNKLASGLTP 179 F+ P+ Y K NPI +PHRT+ GQDLDFVN+V+SHLIHS+W KLN LA+GLT Sbjct: 22 FTKPSVYVKLETRNWNPIPIPHRTIPEPKGQDLDFVNVVNSHLIHSDWAKLNSLANGLTA 81 Query: 178 FRIKHILLKTRKDYVLSLEFFKWVELKNSELNTLDVISIILHILTKNRKFISAESILRR 2 FR+KH+ LK +KDYV+SLEFF WV TL+ S+ILHILTK RKF SAESILR+ Sbjct: 82 FRVKHVFLKVQKDYVVSLEFFNWVGTHKPTSLTLETHSMILHILTKYRKFKSAESILRK 140 >ref|XP_004510327.1| PREDICTED: pentatricopeptide repeat-containing protein At4g26680, mitochondrial-like [Cicer arietinum] Length = 515 Score = 131 bits (329), Expect = 1e-28 Identities = 66/139 (47%), Positives = 93/139 (66%) Frame = -3 Query: 418 MKNLLQWSRFSTFLKPIKAHLKNPIEFSLPTNYKKNPILLPHRTMLPAIGQDLDFVNIVH 239 MK ++++ +FST S+ T KK+ + +PH+T+ GQDLDF+N+ H Sbjct: 1 MKRIIRFHQFSTI--------------SIQTFPKKHYLPIPHQTIPQPKGQDLDFINVFH 46 Query: 238 SHLIHSEWDKLNKLASGLTPFRIKHILLKTRKDYVLSLEFFKWVELKNSELNTLDVISII 59 S++IHS+W+KLN L++ LTPFRIKHILLK + D+VLSL+FF WV N +TL S I Sbjct: 47 SNIIHSQWEKLNPLSNSLTPFRIKHILLKLQNDHVLSLKFFNWVNTHNPNSHTLQTHSFI 106 Query: 58 LHILTKNRKFISAESILRR 2 LHILTKNR F +++SI + Sbjct: 107 LHILTKNRNFRTSQSIFSK 125 >ref|XP_006843235.1| hypothetical protein AMTR_s00080p00074320 [Amborella trichopoda] gi|548845519|gb|ERN04910.1| hypothetical protein AMTR_s00080p00074320 [Amborella trichopoda] Length = 489 Score = 130 bits (327), Expect = 2e-28 Identities = 61/90 (67%), Positives = 73/90 (81%) Frame = -3 Query: 271 GQDLDFVNIVHSHLIHSEWDKLNKLASGLTPFRIKHILLKTRKDYVLSLEFFKWVELKNS 92 GQDLDF+N VHSHLIH EW KLN LA GLTPFR+ HIL+KT+KD+VLSLEFF W + N Sbjct: 6 GQDLDFINFVHSHLIHLEWPKLNSLAHGLTPFRVNHILVKTQKDHVLSLEFFTWAQQTNP 65 Query: 91 ELNTLDVISIILHILTKNRKFISAESILRR 2 TL+ SIILHILTK+RKF SAE++L++ Sbjct: 66 NSQTLETHSIILHILTKSRKFRSAEALLKK 95 >ref|XP_006285690.1| hypothetical protein CARUB_v10007160mg [Capsella rubella] gi|482554395|gb|EOA18588.1| hypothetical protein CARUB_v10007160mg [Capsella rubella] Length = 513 Score = 130 bits (326), Expect = 2e-28 Identities = 69/132 (52%), Positives = 91/132 (68%), Gaps = 1/132 (0%) Frame = -3 Query: 397 SRFSTFLKPIKAHL-KNPIEFSLPTNYKKNPILLPHRTMLPAIGQDLDFVNIVHSHLIHS 221 +RFS+F K L KN S+P +++NP GQDLDFVN+ HSHLI S Sbjct: 9 NRFSSFAGSEKPRLSKNLGAASIPIPHRRNP---------EPKGQDLDFVNVAHSHLIQS 59 Query: 220 EWDKLNKLASGLTPFRIKHILLKTRKDYVLSLEFFKWVELKNSELNTLDVISIILHILTK 41 +WDKLNKL+ L FR+K+IL+K +KDY+LSLEFF W + +N + ++L+ +I+LH LTK Sbjct: 60 DWDKLNKLSDHLDSFRVKNILVKIQKDYLLSLEFFNWAKTRNPDSHSLETHAIVLHTLTK 119 Query: 40 NRKFISAESILR 5 NRKF SAESILR Sbjct: 120 NRKFKSAESILR 131 >ref|XP_002530223.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223530270|gb|EEF32170.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 517 Score = 129 bits (325), Expect = 3e-28 Identities = 61/89 (68%), Positives = 74/89 (83%) Frame = -3 Query: 271 GQDLDFVNIVHSHLIHSEWDKLNKLASGLTPFRIKHILLKTRKDYVLSLEFFKWVELKNS 92 GQDLDFVN+ HSHLIHS+W KL L++ LTPFR+KHILLK +KD+VLSLEFF WV+ +N Sbjct: 29 GQDLDFVNVAHSHLIHSDWKKLTSLSTHLTPFRVKHILLKIQKDHVLSLEFFNWVQTENP 88 Query: 91 ELNTLDVISIILHILTKNRKFISAESILR 5 +TL+ S+ILHILTKNRKF SAE IL+ Sbjct: 89 SSHTLETHSMILHILTKNRKFKSAELILK 117 >ref|XP_002869597.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297315433|gb|EFH45856.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 538 Score = 129 bits (324), Expect = 4e-28 Identities = 68/140 (48%), Positives = 92/140 (65%), Gaps = 1/140 (0%) Frame = -3 Query: 421 NMKNLLQWSRFSTFLKPIKAHL-KNPIEFSLPTNYKKNPILLPHRTMLPAIGQDLDFVNI 245 N + Q+S F+ + + L KNP ++P +PHR+ GQDLDFVN+ Sbjct: 9 NRRLCYQYSSFAGYGRSENPRLSKNPPAANIP---------IPHRSNPEPKGQDLDFVNV 59 Query: 244 VHSHLIHSEWDKLNKLASGLTPFRIKHILLKTRKDYVLSLEFFKWVELKNSELNTLDVIS 65 HSHLI S+WDKLNKL+ L FR+K++LLK +KDY+LS EFF W + +N ++L+ + Sbjct: 60 AHSHLIQSDWDKLNKLSDHLDSFRVKNVLLKIQKDYLLSFEFFNWAKTRNPASHSLETHA 119 Query: 64 IILHILTKNRKFISAESILR 5 I+LH LTKNRKF SAESILR Sbjct: 120 IVLHTLTKNRKFKSAESILR 139 >ref|NP_194398.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|334186944|ref|NP_001190849.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75213515|sp|Q9SZ10.1|PP338_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g26680, mitochondrial; Flags: Precursor gi|4455191|emb|CAB36514.1| putative protein [Arabidopsis thaliana] gi|7269520|emb|CAB79523.1| putative protein [Arabidopsis thaliana] gi|332659836|gb|AEE85236.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332659837|gb|AEE85237.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 521 Score = 127 bits (318), Expect = 2e-27 Identities = 60/99 (60%), Positives = 76/99 (76%) Frame = -3 Query: 301 LPHRTMLPAIGQDLDFVNIVHSHLIHSEWDKLNKLASGLTPFRIKHILLKTRKDYVLSLE 122 +PHR GQDLDFVN+ HSHLI S+WDKLNKL+ L FR+K++LLK +KDY+LSLE Sbjct: 41 IPHRRNPEPKGQDLDFVNVAHSHLIQSDWDKLNKLSDHLDSFRVKNVLLKIQKDYLLSLE 100 Query: 121 FFKWVELKNSELNTLDVISIILHILTKNRKFISAESILR 5 FF W + +N ++L+ +I+LH LTKNRKF SAESILR Sbjct: 101 FFNWAKTRNPGSHSLETHAIVLHTLTKNRKFKSAESILR 139 >ref|XP_006413152.1| hypothetical protein EUTSA_v10024897mg [Eutrema salsugineum] gi|557114322|gb|ESQ54605.1| hypothetical protein EUTSA_v10024897mg [Eutrema salsugineum] Length = 528 Score = 126 bits (317), Expect = 3e-27 Identities = 60/104 (57%), Positives = 80/104 (76%) Frame = -3 Query: 316 KNPILLPHRTMLPAIGQDLDFVNIVHSHLIHSEWDKLNKLASGLTPFRIKHILLKTRKDY 137 +N I +PHR+ GQDLDFVN+ HSHLI S+WD+L+KL+ L FR+K+ILL+ +KDY Sbjct: 43 RNAIPIPHRSNPEPKGQDLDFVNVAHSHLIQSDWDQLDKLSKHLDSFRVKNILLRIQKDY 102 Query: 136 VLSLEFFKWVELKNSELNTLDVISIILHILTKNRKFISAESILR 5 +LSLEFF W + +N ++L+ +I+LH LTKNRKF SAESILR Sbjct: 103 LLSLEFFNWAKTRNPGSHSLETHAIVLHTLTKNRKFKSAESILR 146 >ref|XP_003625044.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355500059|gb|AES81262.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 521 Score = 123 bits (309), Expect = 2e-26 Identities = 66/139 (47%), Positives = 89/139 (64%) Frame = -3 Query: 418 MKNLLQWSRFSTFLKPIKAHLKNPIEFSLPTNYKKNPILLPHRTMLPAIGQDLDFVNIVH 239 MK +++ +FST I++H K + LP +PHRT+ GQDLDF+NI H Sbjct: 1 MKKTIRFHQFST--TSIQSHTKTHSPY-LP---------IPHRTLPQPKGQDLDFINIFH 48 Query: 238 SHLIHSEWDKLNKLASGLTPFRIKHILLKTRKDYVLSLEFFKWVELKNSELNTLDVISII 59 SH IHS+W+KL + LTPF+I+HILLK + D VLSL+FF WV+ N +TL S + Sbjct: 49 SHFIHSQWEKLTPFSKTLTPFKIQHILLKLQNDAVLSLKFFNWVQTHNPNSHTLHTHSFL 108 Query: 58 LHILTKNRKFISAESILRR 2 LHILTKNR F +A+SI + Sbjct: 109 LHILTKNRNFKTAQSIFSK 127 >ref|XP_002320514.2| hypothetical protein POPTR_0014s16390g [Populus trichocarpa] gi|550324329|gb|EEE98829.2| hypothetical protein POPTR_0014s16390g [Populus trichocarpa] Length = 506 Score = 122 bits (307), Expect = 4e-26 Identities = 61/89 (68%), Positives = 72/89 (80%) Frame = -3 Query: 271 GQDLDFVNIVHSHLIHSEWDKLNKLASGLTPFRIKHILLKTRKDYVLSLEFFKWVELKNS 92 GQDLDFVN+VHSHLIHS+WDKLNKL++ TPFR+ HILLK +KD+VLSLEFF ++ N Sbjct: 20 GQDLDFVNVVHSHLIHSDWDKLNKLSTHFTPFRVNHILLKIQKDHVLSLEFFNSLKTLNP 79 Query: 91 ELNTLDVISIILHILTKNRKFISAESILR 5 TL+ SIILHILTK KF SA+SILR Sbjct: 80 ISLTLETHSIILHILTKKSKFKSAQSILR 108 >ref|XP_003531640.1| PREDICTED: pentatricopeptide repeat-containing protein At4g26680, mitochondrial-like isoform 2 [Glycine max] Length = 522 Score = 102 bits (254), Expect = 5e-20 Identities = 59/139 (42%), Positives = 84/139 (60%), Gaps = 2/139 (1%) Frame = -3 Query: 418 MKNLLQWSRFSTFLKPIKAHLKNPIE--FSLPTNYKKNPILLPHRTMLPAIGQDLDFVNI 245 M+N+ Q RFST ++P K P F LP +PHRT+ GQDLDF+ + Sbjct: 1 MRNI-QPHRFSTLIEPPN---KTPTSKPFFLP---------IPHRTIPEPRGQDLDFICV 47 Query: 244 VHSHLIHSEWDKLNKLASGLTPFRIKHILLKTRKDYVLSLEFFKWVELKNSELNTLDVIS 65 H H+I+S W+KL L++ LTPFR+KH+LL + D+V SL+ WV N +TLD S Sbjct: 48 AHRHVINSHWEKLLPLSTSLTPFRLKHLLLALQNDHVSSLKLSTWVLKHNPSSHTLDTHS 107 Query: 64 IILHILTKNRKFISAESIL 8 I+LH L+K+R+F + + L Sbjct: 108 ILLHTLSKHRQFKTTQKFL 126