BLASTX nr result
ID: Rehmannia23_contig00001086
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00001086 (349 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC09698.1| Histone [Morus notabilis] 100 3e-19 ref|XP_003552025.2| PREDICTED: histone H3.3-like [Glycine max] 100 3e-19 gb|ESW35662.1| hypothetical protein PHAVU_001G253800g [Phaseolus... 100 3e-19 ref|XP_006411806.1| hypothetical protein EUTSA_v10026962mg [Eutr... 100 3e-19 ref|XP_006386413.1| hypothetical protein POPTR_0002s10030g [Popu... 100 3e-19 ref|XP_006851804.1| hypothetical protein AMTR_s00041p00020660 [A... 100 3e-19 dbj|BAN42603.1| putative histone H3, partial [Pyrus pyrifolia va... 100 3e-19 ref|XP_006425525.1| hypothetical protein CICLE_v10026741mg [Citr... 100 3e-19 ref|XP_006288773.1| hypothetical protein CARUB_v10002094mg, part... 100 3e-19 gb|EMT02210.1| Histone H3.3 [Aegilops tauschii] 100 3e-19 gb|EMS66058.1| Histone H3.3 [Triticum urartu] 100 3e-19 gb|EMS58978.1| Histone H3.3 [Triticum urartu] gi|475497358|gb|EM... 100 3e-19 gb|EMS58296.1| Histone H3.3 [Triticum urartu] 100 3e-19 gb|AAB03542.1| histone H3, partial [Triticum aestivum] 100 3e-19 gb|AAB03538.1| histone H3, partial [Glycine max] gi|1053049|gb|A... 100 3e-19 gb|AAF87128.1|AC006434_24 F10A5.19 [Arabidopsis thaliana] 100 3e-19 gb|AAB03537.1| histone H3, partial [Glycine max] 100 3e-19 gb|AAX92698.1| histone 3 [Picea abies] 100 3e-19 gb|AAX92699.1| histone 3 [Picea abies] gi|62642123|gb|AAX92700.1... 100 3e-19 ref|NP_172794.1| histone H3 [Arabidopsis thaliana] gi|75172979|... 100 3e-19 >gb|EXC09698.1| Histone [Morus notabilis] Length = 159 Score = 99.8 bits (247), Expect = 3e-19 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -3 Query: 347 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 201 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA Sbjct: 90 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 138 >ref|XP_003552025.2| PREDICTED: histone H3.3-like [Glycine max] Length = 186 Score = 99.8 bits (247), Expect = 3e-19 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -3 Query: 347 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 201 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA Sbjct: 117 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 165 >gb|ESW35662.1| hypothetical protein PHAVU_001G253800g [Phaseolus vulgaris] Length = 202 Score = 99.8 bits (247), Expect = 3e-19 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -3 Query: 347 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 201 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA Sbjct: 133 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 181 >ref|XP_006411806.1| hypothetical protein EUTSA_v10026962mg [Eutrema salsugineum] gi|557112976|gb|ESQ53259.1| hypothetical protein EUTSA_v10026962mg [Eutrema salsugineum] Length = 125 Score = 99.8 bits (247), Expect = 3e-19 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -3 Query: 347 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 201 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA Sbjct: 56 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 104 >ref|XP_006386413.1| hypothetical protein POPTR_0002s10030g [Populus trichocarpa] gi|550344676|gb|ERP64210.1| hypothetical protein POPTR_0002s10030g [Populus trichocarpa] Length = 192 Score = 99.8 bits (247), Expect = 3e-19 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -3 Query: 347 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 201 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA Sbjct: 67 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 115 >ref|XP_006851804.1| hypothetical protein AMTR_s00041p00020660 [Amborella trichopoda] gi|548855387|gb|ERN13271.1| hypothetical protein AMTR_s00041p00020660 [Amborella trichopoda] Length = 136 Score = 99.8 bits (247), Expect = 3e-19 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -3 Query: 347 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 201 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA Sbjct: 67 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 115 >dbj|BAN42603.1| putative histone H3, partial [Pyrus pyrifolia var. culta] gi|511093976|dbj|BAN42604.1| putative histone H3, partial [Pyrus pyrifolia var. culta] Length = 86 Score = 99.8 bits (247), Expect = 3e-19 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -3 Query: 347 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 201 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA Sbjct: 17 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 65 >ref|XP_006425525.1| hypothetical protein CICLE_v10026741mg [Citrus clementina] gi|568825090|ref|XP_006466922.1| PREDICTED: histone H3.3-like [Citrus sinensis] gi|508698995|gb|EOX90891.1| Histone superfamily protein [Theobroma cacao] gi|557527515|gb|ESR38765.1| hypothetical protein CICLE_v10026741mg [Citrus clementina] Length = 136 Score = 99.8 bits (247), Expect = 3e-19 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -3 Query: 347 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 201 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA Sbjct: 67 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 115 >ref|XP_006288773.1| hypothetical protein CARUB_v10002094mg, partial [Capsella rubella] gi|482557479|gb|EOA21671.1| hypothetical protein CARUB_v10002094mg, partial [Capsella rubella] Length = 175 Score = 99.8 bits (247), Expect = 3e-19 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -3 Query: 347 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 201 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA Sbjct: 106 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 154 >gb|EMT02210.1| Histone H3.3 [Aegilops tauschii] Length = 150 Score = 99.8 bits (247), Expect = 3e-19 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -3 Query: 347 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 201 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA Sbjct: 81 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 129 >gb|EMS66058.1| Histone H3.3 [Triticum urartu] Length = 94 Score = 99.8 bits (247), Expect = 3e-19 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -3 Query: 347 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 201 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA Sbjct: 25 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 73 >gb|EMS58978.1| Histone H3.3 [Triticum urartu] gi|475497358|gb|EMT03998.1| Histone H3.3 [Aegilops tauschii] gi|475497359|gb|EMT03999.1| Histone H3.3 [Aegilops tauschii] Length = 137 Score = 99.8 bits (247), Expect = 3e-19 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -3 Query: 347 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 201 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA Sbjct: 68 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 116 >gb|EMS58296.1| Histone H3.3 [Triticum urartu] Length = 124 Score = 99.8 bits (247), Expect = 3e-19 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -3 Query: 347 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 201 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA Sbjct: 55 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 103 >gb|AAB03542.1| histone H3, partial [Triticum aestivum] Length = 127 Score = 99.8 bits (247), Expect = 3e-19 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -3 Query: 347 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 201 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA Sbjct: 67 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 115 >gb|AAB03538.1| histone H3, partial [Glycine max] gi|1053049|gb|AAB03539.1| histone H3, partial [Glycine max] gi|1053051|gb|AAB03540.1| histone H3, partial [Glycine max] Length = 127 Score = 99.8 bits (247), Expect = 3e-19 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -3 Query: 347 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 201 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA Sbjct: 67 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 115 >gb|AAF87128.1|AC006434_24 F10A5.19 [Arabidopsis thaliana] Length = 236 Score = 99.8 bits (247), Expect = 3e-19 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -3 Query: 347 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 201 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA Sbjct: 167 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 215 Score = 98.6 bits (244), Expect = 8e-19 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 347 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 201 PFQRLVREIAQD+KTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA Sbjct: 67 PFQRLVREIAQDYKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 115 >gb|AAB03537.1| histone H3, partial [Glycine max] Length = 127 Score = 99.8 bits (247), Expect = 3e-19 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -3 Query: 347 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 201 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA Sbjct: 67 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 115 >gb|AAX92698.1| histone 3 [Picea abies] Length = 136 Score = 99.8 bits (247), Expect = 3e-19 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -3 Query: 347 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 201 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA Sbjct: 67 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 115 >gb|AAX92699.1| histone 3 [Picea abies] gi|62642123|gb|AAX92700.1| histone 3 [Picea abies] Length = 141 Score = 99.8 bits (247), Expect = 3e-19 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -3 Query: 347 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 201 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA Sbjct: 67 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 115 >ref|NP_172794.1| histone H3 [Arabidopsis thaliana] gi|75172979|sp|Q9FX60.3|H3L1_ARATH RecName: Full=Histone H3-like 1 gi|9958067|gb|AAG09556.1|AC011810_15 Putative histone H3 [Arabidopsis thaliana] gi|149944357|gb|ABR46221.1| At1g13370 [Arabidopsis thaliana] gi|332190887|gb|AEE29008.1| histone H3 [Arabidopsis thaliana] Length = 136 Score = 99.8 bits (247), Expect = 3e-19 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -3 Query: 347 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 201 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA Sbjct: 67 PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA 115