BLASTX nr result
ID: Rehmannia23_contig00000917
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00000917 (464 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ02207.1| hypothetical protein PRUPE_ppa005371mg [Prunus pe... 56 4e-06 ref|XP_002280897.1| PREDICTED: zinc finger CCCH domain-containin... 55 7e-06 >gb|EMJ02207.1| hypothetical protein PRUPE_ppa005371mg [Prunus persica] Length = 464 Score = 56.2 bits (134), Expect = 4e-06 Identities = 22/38 (57%), Positives = 31/38 (81%) Frame = -1 Query: 464 QRMGAVIPSQDGAPGGPSGSNENKSGSDQKQAHQQYGY 351 QRMGA++PSQ+GAP GP+GS EN SG++++Q Q Y + Sbjct: 332 QRMGAIVPSQEGAPSGPTGSGENNSGAERQQRSQHYAF 369 >ref|XP_002280897.1| PREDICTED: zinc finger CCCH domain-containing protein 49-like [Vitis vinifera] Length = 474 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/38 (60%), Positives = 31/38 (81%) Frame = -1 Query: 464 QRMGAVIPSQDGAPGGPSGSNENKSGSDQKQAHQQYGY 351 QRMGA++PSQ+GAP G +G +ENK+GSD++Q Q Y Y Sbjct: 374 QRMGALVPSQEGAPSGSAGPSENKAGSDKQQQGQHYAY 411