BLASTX nr result
ID: Rehmannia23_contig00000792
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00000792 (381 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS64937.1| hypothetical protein M569_09840, partial [Genlise... 67 2e-09 gb|AFD64619.1| putative hydroxycinnamoyl-CoA:shikimate/quinate h... 58 1e-06 >gb|EPS64937.1| hypothetical protein M569_09840, partial [Genlisea aurea] Length = 423 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +1 Query: 241 VTFKATHIVRPSEPTPDEIMYLNASDQIKDITHTPTIYFYK 363 VT + VRP+EPTP +MYLNASDQIKDI+HTPTIYFY+ Sbjct: 1 VTITGRYTVRPAEPTPSGVMYLNASDQIKDISHTPTIYFYR 41 >gb|AFD64619.1| putative hydroxycinnamoyl-CoA:shikimate/quinate hydroxycinnamoyltransferase [Camellia sinensis] Length = 447 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/47 (51%), Positives = 35/47 (74%) Frame = +1 Query: 238 MVTFKATHIVRPSEPTPDEIMYLNASDQIKDITHTPTIYFYKHSPAL 378 MV KA+++V+P++ TP +MYL+ DQ ITH+PT+YFY+HS L Sbjct: 1 MVNLKASYMVKPAKETPTRLMYLSEFDQFDTITHSPTVYFYQHSGEL 47