BLASTX nr result
ID: Rauwolfia21_contig00057722
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00057722 (288 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004251526.1| PREDICTED: TBC1 domain family member 2A-like... 57 3e-06 ref|XP_004251525.1| PREDICTED: TBC1 domain family member 2A-like... 57 3e-06 ref|XP_006357988.1| PREDICTED: TBC1 domain family member 2B-like... 56 6e-06 ref|XP_004243501.1| PREDICTED: TBC1 domain family member 2A-like... 56 6e-06 >ref|XP_004251526.1| PREDICTED: TBC1 domain family member 2A-like isoform 2 [Solanum lycopersicum] Length = 344 Score = 56.6 bits (135), Expect = 3e-06 Identities = 36/78 (46%), Positives = 42/78 (53%), Gaps = 14/78 (17%) Frame = -2 Query: 287 ALEFDVSLVCTEWFLCLFSKSLPSEVDLSDF-------------VLIAELKKNIHPLLSM 147 ALEFDVSLVCTEWFLCLF+KSLPSE L + V +A K N LL++ Sbjct: 215 ALEFDVSLVCTEWFLCLFAKSLPSETTLRVWDVLFNEGANLLFHVALAIFKMNEEELLTV 274 Query: 146 *QPWDPLQ-STICTHSTF 96 D + CTH F Sbjct: 275 HHVGDVIHIIQRCTHQLF 292 >ref|XP_004251525.1| PREDICTED: TBC1 domain family member 2A-like isoform 1 [Solanum lycopersicum] gi|565370727|ref|XP_006351970.1| PREDICTED: TBC1 domain family member 2B-like [Solanum tuberosum] Length = 394 Score = 56.6 bits (135), Expect = 3e-06 Identities = 36/78 (46%), Positives = 42/78 (53%), Gaps = 14/78 (17%) Frame = -2 Query: 287 ALEFDVSLVCTEWFLCLFSKSLPSEVDLSDF-------------VLIAELKKNIHPLLSM 147 ALEFDVSLVCTEWFLCLF+KSLPSE L + V +A K N LL++ Sbjct: 265 ALEFDVSLVCTEWFLCLFAKSLPSETTLRVWDVLFNEGANLLFHVALAIFKMNEEELLTV 324 Query: 146 *QPWDPLQ-STICTHSTF 96 D + CTH F Sbjct: 325 HHVGDVIHIIQRCTHQLF 342 >ref|XP_006357988.1| PREDICTED: TBC1 domain family member 2B-like [Solanum tuberosum] Length = 394 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -2 Query: 287 ALEFDVSLVCTEWFLCLFSKSLPSEVDL 204 +LEFDVSLVCTEWFLCLFSKSLPSE L Sbjct: 265 SLEFDVSLVCTEWFLCLFSKSLPSETTL 292 >ref|XP_004243501.1| PREDICTED: TBC1 domain family member 2A-like [Solanum lycopersicum] Length = 394 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -2 Query: 287 ALEFDVSLVCTEWFLCLFSKSLPSEVDL 204 +LEFDVSLVCTEWFLCLFSKSLPSE L Sbjct: 265 SLEFDVSLVCTEWFLCLFSKSLPSETTL 292