BLASTX nr result
ID: Rauwolfia21_contig00056931
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00056931 (366 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB45115.1| hypothetical protein L484_019340 [Morus notabilis] 64 2e-08 ref|XP_003614397.1| hypothetical protein MTR_5g051160 [Medicago ... 56 6e-06 ref|XP_003614383.1| hypothetical protein MTR_5g051000 [Medicago ... 56 6e-06 >gb|EXB45115.1| hypothetical protein L484_019340 [Morus notabilis] Length = 122 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/44 (65%), Positives = 34/44 (77%), Gaps = 2/44 (4%) Frame = -1 Query: 198 GQKLPPNWGYIPQQPNSPTAPHDAPTPKHN--LTLYGAPFRGTY 73 GQ LPPNWGYIP+QP+SPT P A KH+ LTL GAPF+GT+ Sbjct: 53 GQNLPPNWGYIPKQPDSPTVPRGATGSKHDKTLTLSGAPFQGTW 96 >ref|XP_003614397.1| hypothetical protein MTR_5g051160 [Medicago truncatula] gi|355515732|gb|AES97355.1| hypothetical protein MTR_5g051160 [Medicago truncatula] Length = 356 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/49 (53%), Positives = 36/49 (73%), Gaps = 2/49 (4%) Frame = -1 Query: 198 GQKLPPNWGYIPQQPNSPTAPHDAPTPKHN--LTLYGAPFRGTYPQCLS 58 G+ LPP+WG IP+QP+S TAP A +HN LTL GAPF+GT+ + ++ Sbjct: 201 GRNLPPDWGCIPKQPDSLTAPRGATGSEHNGALTLSGAPFQGTWARSVA 249 >ref|XP_003614383.1| hypothetical protein MTR_5g051000 [Medicago truncatula] gi|355515718|gb|AES97341.1| hypothetical protein MTR_5g051000 [Medicago truncatula] Length = 1735 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/49 (53%), Positives = 36/49 (73%), Gaps = 2/49 (4%) Frame = -1 Query: 198 GQKLPPNWGYIPQQPNSPTAPHDAPTPKHN--LTLYGAPFRGTYPQCLS 58 G+ LPP+WG IP+QP+S TAP A +HN LTL GAPF+GT+ + ++ Sbjct: 339 GRNLPPDWGCIPKQPDSLTAPRGATGSEHNGALTLSGAPFQGTWARSVA 387