BLASTX nr result
ID: Rauwolfia21_contig00056148
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00056148 (292 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_001109547.1| hypothetical protein Poptr_cp068 [Populus tr... 43 9e-06 >ref|YP_001109547.1| hypothetical protein Poptr_cp068 [Populus trichocarpa] gi|134093271|ref|YP_001109572.1| hypothetical protein Poptr_cp095 [Populus trichocarpa] gi|133712108|gb|ABO36751.1| conserved hypothetical protein [Populus trichocarpa] gi|133712133|gb|ABO36776.1| conserved hypothetical protein [Populus trichocarpa] Length = 61 Score = 42.7 bits (99), Expect(2) = 9e-06 Identities = 19/39 (48%), Positives = 24/39 (61%) Frame = -2 Query: 171 WSISIDWACHIGPSWTSKCF*FELSGECLRYIKKMNNQT 55 WSISID +CHIGPS TS CF + L + + N Q+ Sbjct: 10 WSISIDRSCHIGPSQTSNCFDLNYPEDALSILYQKNGQS 48 Score = 32.3 bits (72), Expect(2) = 9e-06 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -1 Query: 82 IYQKDEQSNLFLDLIKA*RGE 20 +YQK+ QSNLFLD I+A RGE Sbjct: 41 LYQKNGQSNLFLDSIEAKRGE 61