BLASTX nr result
ID: Rauwolfia21_contig00055824
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00055824 (274 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY01736.1| Cobalamin biosynthesis CobW-like protein [Theobro... 56 4e-06 >gb|EOY01736.1| Cobalamin biosynthesis CobW-like protein [Theobroma cacao] Length = 657 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +1 Query: 1 VVDAKNIHYQLKSHQDSSSFPEAYLQIAFA 90 VVDAKN+H+QL SH+DSSSFPEA+LQIAFA Sbjct: 163 VVDAKNLHFQLNSHRDSSSFPEAFLQIAFA 192