BLASTX nr result
ID: Rauwolfia21_contig00055563
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00055563 (410 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006345456.1| PREDICTED: telomerase reverse transcriptase-... 64 3e-08 ref|XP_004229622.1| PREDICTED: telomerase reverse transcriptase-... 62 8e-08 ref|XP_006345457.1| PREDICTED: telomerase reverse transcriptase-... 61 2e-07 gb|AFJ00032.1| telomerase reverse transcriptase, partial [Nicoti... 57 3e-06 gb|AEA72244.1| telomerase reverse transcriptase, partial [Nicoti... 57 3e-06 gb|AEB33869.1| telomerase reverse transcriptase, partial [Nicoti... 55 7e-06 >ref|XP_006345456.1| PREDICTED: telomerase reverse transcriptase-like isoform X1 [Solanum tuberosum] Length = 988 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/58 (53%), Positives = 40/58 (68%) Frame = -3 Query: 279 YHAIIKQLKSLIRKARGCQHLRLLDKHCVIPSLGQDTYVGSGVVTEGGKFGKNLDGNE 106 YH+IIK LKSLIRKA CQHLRLL++HC PSL QDT + + +G K ++ N+ Sbjct: 185 YHSIIKLLKSLIRKAHQCQHLRLLEEHCSAPSLDQDTKNIAATILKGNKSEASIFPND 242 >ref|XP_004229622.1| PREDICTED: telomerase reverse transcriptase-like [Solanum lycopersicum] Length = 1215 Score = 62.0 bits (149), Expect = 8e-08 Identities = 35/82 (42%), Positives = 50/82 (60%), Gaps = 2/82 (2%) Frame = -3 Query: 279 YHAIIKQLKSLIRKARGCQHLRLLDKHCVIPSLGQDTYVGSGVVTEGGKFGKNLDGNEYA 100 YH+IIK LKSLIRKA CQHLRLL+KHC PS+ QD + + + K ++ N+ Sbjct: 412 YHSIIKLLKSLIRKAHHCQHLRLLEKHCSAPSVDQDAKNIAATILKANKSEASVPANDCP 471 Query: 99 GVPVA-CDLPLEKCH-SSDSRS 40 +A D + C+ +S+S+S Sbjct: 472 ENGIAHSDFKSDSCNTTSESQS 493 >ref|XP_006345457.1| PREDICTED: telomerase reverse transcriptase-like isoform X2 [Solanum tuberosum] Length = 819 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -3 Query: 279 YHAIIKQLKSLIRKARGCQHLRLLDKHCVIPSLGQDT 169 YH+IIK LKSLIRKA CQHLRLL++HC PSL QDT Sbjct: 403 YHSIIKLLKSLIRKAHQCQHLRLLEEHCSAPSLDQDT 439 >gb|AFJ00032.1| telomerase reverse transcriptase, partial [Nicotiana tomentosiformis] Length = 511 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -3 Query: 279 YHAIIKQLKSLIRKARGCQHLRLLDKHCVIPSLGQDT 169 YH+IIK LK+LIRKA CQH+RLL+KHC PSL Q T Sbjct: 239 YHSIIKLLKTLIRKAHHCQHVRLLEKHCSTPSLDQCT 275 >gb|AEA72244.1| telomerase reverse transcriptase, partial [Nicotiana tomentosiformis] Length = 668 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -3 Query: 279 YHAIIKQLKSLIRKARGCQHLRLLDKHCVIPSLGQDT 169 YH+IIK LK+LIRKA CQH+RLL+KHC PSL Q T Sbjct: 241 YHSIIKLLKTLIRKAHHCQHVRLLEKHCSTPSLDQCT 277 >gb|AEB33869.1| telomerase reverse transcriptase, partial [Nicotiana tabacum] Length = 537 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/38 (71%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Frame = -3 Query: 279 YHAIIKQLKSLIRKARGCQHLRLLDKHC-VIPSLGQDT 169 YH+IIK LK+LIRKA CQH+RLL+KHC PSL QDT Sbjct: 264 YHSIIKLLKTLIRKAHHCQHVRLLEKHCSSTPSLDQDT 301